KEGG   Salmonella enterica subsp. enterica serovar Choleraesuis: SC0181Help
Entry
SC0181            CDS       T00240                                 

Gene name
panC
Definition
pantoate--beta-alanine ligase (EC:6.3.2.1)
Orthology
K01918  
pantoate--beta-alanine ligase [EC:6.3.2.1]
Organism
sec  Salmonella enterica subsp. enterica serovar Choleraesuis
Pathway
beta-Alanine metabolism
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Pantothenate biosynthesis, valine/L-aspartate => pantothenate
Class
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:sec00410]
Metabolism; Metabolism of cofactors and vitamins; Pantothenate and CoA biosynthesis [PATH:sec00770]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(207612..208466)
Genome map
AA seq 284 aa AA seqDB search
MLIIETLPLLRQHIRRLRQEGKRVALVPTMGNLHDGHMKLVDEAKARADVVIVSIFVNPM
QFDRPDDLVRYPRTLQEDCEKLNKRKVDYVFAPAVEEIYPQGLEGQTYVDVPGLSTMLEG
ASRPGHFRGVSTIVSKLFNLIQPDIACFGEKDFQQLALIRKMVADMSYDIEIVGVPIIRA
KDGLALSSRNAYLTAEQRKIAPGLYNVMNSIAEKLIAGNRELQEIIAIAEQELNEKGFRA
DDIQIRDADTLQELTETSKRAVILAAAWLGQARLIDNQSVTLAQ
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
gtgctaatcattgaaaccctgccgctgctgcgccagcatattcgtcgtctgcgtcaggaa
ggtaaacgcgtcgcactggttcccaccatgggcaacctgcacgacggccatatgaagctg
gtcgatgaggcaaaagcccgggctgatgtggtgatcgtcagcattttcgtcaatccgatg
cagtttgatcggccggacgatctggtgcgttatccgcgcacgctgcaggaagattgtgaa
aagctgaacaaacgcaaagtcgattatgtctttgcgccagccgttgaggaaatctaccca
caggggctggaaggccagacgtacgttgatgttcccggcctctccaccatgctggaaggc
gccagccgtccgggccacttccgcggcgtctcgactatcgtcagcaagctgttcaacctg
atccagccggatatcgcctgctttggcgagaaggatttccagcaactggcgctgatccgt
aaaatggtggcggatatgagttatgacattgagatcgtcggcgtgccgattattcgcgct
aaagacggtctggcgctcagctcacgtaacgcttatctgaccgcagagcagcgcaaaatt
gcgccgggtctatacaacgtgatgaatagcatcgctgaaaaactgattgcgggtaatcgt
gagctgcaagagattattgccattgccgaacaggaactgaatgaaaaaggcttccgtgcc
gacgacattcaaatccgtgatgccgacacgctgcaggagctgacggaaaccagcaaacgc
gcagtgattctggccgccgcctggctgggtcaggcgcgtctgatcgataatcaaagcgtt
acattagcccagtag

DBGET integrated database retrieval system