KEGG   Salmonella enterica subsp. enterica serovar Choleraesuis: SC0399Help
Entry
SC0399            CDS       T00240                                 

Gene name
res
Definition
DNA restriction (DNA helicase
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
sec  Salmonella enterica subsp. enterica serovar Choleraesuis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
449840..452812
Genome map
AA seq 990 aa AA seqDB search
MMNILLEELPHQEQALAAILASFTGIDHAQADHNHYANPLIKERYDDKANIDVKMETGTG
KTYVYTRLMYELHQKYGLFKFVLVVPTPAIKEGARNFITSDYARQHFSQFYENTRMELCT
INAGDFKVKSGRKNFPAQLLSFTDASRRDSHTIQVLLINAQMLNSASMTRDDYDQTLLGG
LTSPVKGLQMTRPVVIIDEPHRFARDNKFYRAIQAIQPQMIVRFGATFPDIVEGKGKNKC
VRKDYYRRQPQFDLNAVDSFNDGLVKGIDIYYPNLPEEQANNRYIVDSVTAKKLILRRGS
KIAEVGVGENLADVDAGFEGSIEYAGSKMLSNDLELEAGMALVPGTFGASYQELIIQDAI
DKHFDTEQANFLRSNEPENNAPRIKTLSLFFIDSIKSYRDDEGWLKLKFECLLKKKLTQL
IDDYQRKTLPREVEYLSFLQATLASLHSDNQNVHAGYFGEDRGSGDEAIQAEVDDILKNK
EKLLSFSDHHGNWETRRFLFSKWTLREGWDNPNVFVIAKLRSSGSESSKIQEVGRGLRLP
VDENGHRVHQEEWPSRLSFLIGYDEKAFASMLVDEINRDSKVQLNEQKLDEAMITLIVTE
RQKVDPAFTELRLLEDLDDKKLINRSNEFKPSVTLNGETKSGFAWLLEFYPELTQARVRA
DRIRDNKPASRLRVRLRKENWEQLSSIWEQFSRRYMLQFERSGASLEQIAAEVLRDPSLY
IRQKPSQVQQRLVSNEDNGRFEVAQREGELAASEFMAGMKYGHFLKQLALRTSLPVNVLH
PVLMAMLRDVLHGDSRYLSEISLDNMTRALQTRINAHFAQRHDYLPLDFQASTSVFDSTA
RQFREEISAEIVGKNVDENAIYDPRSLYQIPPLRYDSVDPELPLLKYDYPQQVSVFGKLP
KRAIQIPKYTGGSTTPDFVYRIERQDADSVYLLVETKAENMRVGDQVILDAQRKFFDMLR
RQNINVEFAEATSAPAVFSTINGLIEGKAN
NT seq 2973 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatattttactggaagaacttccccatcaggaacaggcgttagcggcgattctg
gcgagtttcaccggtatcgatcacgcgcaagccgatcataatcactatgctaatccgctg
attaaggaacgttacgacgataaggccaatattgacgttaaaatggagaccgggacgggt
aaaacctatgtctatacccggttgatgtatgaattgcatcagaagtatggcctcttcaaa
tttgtgctggtggtgccgacgccagccattaaagaaggcgcgcggaactttattaccagc
gattacgccagacagcatttttcacagttctacgaaaatacgcggatggaactttgcacc
atcaacgccggtgattttaaagtaaagtcggggcgtaaaaattttccggcccagctatta
agttttactgatgccagccgtcgtgatagccatacgattcaggttttgctgatcaatgcg
caaatgctcaattccgccagtatgacgcgagacgattacgatcaaacgctactgggcggg
ctgacgtcgcctgttaaagggctgcaaatgacgcgaccggtggtcattattgatgaaccg
catcgttttgcgcgagataacaaattttatcgagcgattcaggctattcagccgcaaatg
atcgtccgctttggcgctaccttcccggatattgtcgaaggtaagggtaaaaataaatgt
gtacgtaaagattactatcgccggcaaccgcagtttgatctcaacgcggtggacagtttt
aacgatggtttggtgaaaggtattgatatttattacccgaatctccccgaagaacaggcc
aacaatcgttatatcgttgacagcgtcacggcaaagaaattaatcctccgacgggggagc
aaaattgccgaggttggcgtgggcgaaaatctcgccgatgtcgatgcaggatttgaaggc
agtattgaatatgccggcagtaaaatgttgtcgaacgatctggagctggaggcagggatg
gcgctggtgccaggaacctttggcgcgagctaccaggaactgattattcaggacgccatt
gataagcattttgataccgagcaggcaaatttcttacgcagcaatgagccagaaaataat
gccccgcgtattaagaccttaagccttttctttattgacagtattaaaagctatcgtgat
gacgaaggttggttgaaactgaagtttgagtgtttactgaaaaagaaactgacgcaactg
attgacgattatcagcgcaagaccctgccgcgagaagtggagtatctgtcgtttctgcag
gccacgctcgccagcctgcactcggataaccaaaacgtccacgctggttactttggcgaa
gaccgcggaagcggcgatgaggcgatccaggctgaggtagatgatattctgaaaaataaa
gagaagttgctcagtttttcagaccatcacggcaactgggaaacgcgccgctttctgttt
tcaaaatggacgcttcgcgaaggctgggataacccgaatgtttttgtcattgctaaatta
cgttcttccggtagcgagtcgagcaaaattcaggaagtggggcgcggcctgcggctaccg
gtagatgaaaacggccatcgcgttcatcaggaagagtggccgtcccgactgtcgtttctg
attggttatgatgaaaaagcgtttgccagtatgctggttgatgagattaatcgcgacagc
aaagttcagcttaacgagcagaagctggatgaggcgatgatcacactcatcgtcaccgag
cgacaaaaagtcgatcctgcgtttacggagcttcgtttgctggaagatctggatgataaa
aaactgatcaaccggagtaatgagtttaaacccagcgtcacgcttaacggggaaaccaaa
agtggctttgcgtggctactggagttctaccctgagctgacgcaggcgcgggtgcgagcg
gatcgcattcgtgacaataagcccgcctcccgactgcgagtcaggttacgcaaagagaat
tgggaacaacttagcagtatctgggagcagttttcccgccgttatatgctgcaattcgag
cgtagcggcgcttctctggaacagattgccgccgaggtgctgcgcgatccgtcgctgtat
atacgccagaagccaagccaggtgcaacaacggctggtatcgaatgaagataatggccgt
tttgaagtggcgcagcgggaaggcgaattagccgccagcgaatttatggcgggcatgaaa
tatggccattttcttaagcaactggcgttacgcaccagtctgccggttaacgtcctgcac
ccggtgttaatggcgatgctgcgtgatgttttgcacggagattcacgctatttaagcgag
atctcgttggacaatatgacccgcgcattacagacgcggattaatgcgcattttgcgcag
cgccacgattatctgcctctcgacttccaggcttcaacgtcggtatttgattccacggca
cggcagttcagagaggagattagcgctgaaattgtggggaaaaatgtggatgagaatgcg
atatacgatcctcgttctctctatcaaataccgccgttgcgttatgacagcgtcgatcca
gaattgccgctattaaaatacgattatccgcaacaggtttctgtgtttggcaaactgcct
aagcgggccattcagatccccaaatatacgggaggctctactacgccggattttgtgtac
cgtattgagcgtcaggacgccgacagcgtttatttactggttgaaactaaagcagaaaat
atgcgcgtaggcgatcaggttattcttgatgcgcaacgtaaattcttcgatatgctgcgt
cggcaaaatattaatgtcgagtttgcggaagcgaccagcgcgccggcggtattttctacg
atcaatggcttgattgaggggaaggcaaactaa

DBGET integrated database retrieval system