KEGG   Salmonella enterica subsp. enterica serovar Choleraesuis: SC0434Help
Entry
SC0434            CDS       T00240                                 

Gene name
yajF
Definition
fructokinase (EC:2.7.1.4)
Orthology
K00847  
fructokinase [EC:2.7.1.4]
Organism
sec  Salmonella enterica subsp. enterica serovar Choleraesuis
Pathway
Fructose and mannose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sec00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SC0434 (yajF)
   00500 Starch and sucrose metabolism
    SC0434 (yajF)
   00520 Amino sugar and nucleotide sugar metabolism
    SC0434 (yajF)
Enzymes [BR:sec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     SC0434 (yajF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
488460..489368
Genome map
AA seq 302 aa AA seqDB search
MRIGIDLGGTKTEVIALDDAGEQRFRHRLPTPREDYQQTIETIATLVDMAEQATGQTGSV
GIGIPGSLSPYTGVVKNANSTWLNGQPFDSDVSRRLKRAVRLANDANCLAVSEAVDGAAA
GAQTVFAVIIGTGCGAGVALNGRTHIGGNGTAGEWGHNPLPWMDDDELRYREEIPCYCGK
QGCIETFISGTGFATDYQHLSGNALKGDEIIRLVDAQDAVAELALSRYELRLAKALSHVV
NILDPDVIVLGGGMSNVERLYKTVPSLMKSFVFGGECETPVRKARHGDSSGVRGAAWLWP
LA
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtattggtatcgatttaggcggcacaaaaacggaagtcattgcgcttgatgatgca
ggagagcagcggtttcgccatcgtctgcctacgccgcgggaggattatcagcaaacgata
gaaaccatcgctacgctggtcgacatggcggaacaggcgaccggccagaccggtagcgtt
ggcattggcattcccggttctctctcgccttacaccggcgtggtaaaaaacgctaactct
acgtggcttaacggccagccgttcgatagcgatgtgagccgtcgtctgaagcgtgcagtg
cggttagccaacgatgccaattgcctggcggtatcagaggcggtagatggcgctgcggcg
ggggcgcaaacggtgtttgcggtgattatcggtaccgggtgcggcgcgggcgtagcgcta
aatggccggacgcacatcggcggcaacggtacggcaggcgaatggggccacaatccgttg
ccgtggatggatgacgatgagttgcgttaccgcgaagaaattccctgttattgcggtaaa
caaggctgtatcgaaacctttatttccggtacgggatttgccacggattaccagcatttg
agcggtaacgcgctaaaaggcgatgagattattcgtctggtcgacgcgcaggacgccgtg
gcggaactggcgttaagccgttatgagctacggctggcgaaagcattatctcatgtcgtg
aatattctggatccggatgtcattgtgctgggcggcggtatgagcaatgttgagcgcctg
tacaagacggttccgtcgctgatgaaatcgtttgtttttggcggcgagtgcgagacgccg
gtacgtaaggcgcggcatggcgattcaagcggcgtgcgcggcgcggcctggctgtggccg
ctggcgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system