KEGG   Salmonella enterica subsp. enterica serovar Choleraesuis: SC0434Help
Entry
SC0434            CDS       T00240                                 

Gene name
yajF
Definition
fructokinase (EC:2.7.1.4)
Orthology
K00847  
fructokinase [EC:2.7.1.4]
Organism
sec  Salmonella enterica subsp. enterica serovar Choleraesuis
Pathway
Fructose and mannose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:sec00051]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sec00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sec00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
488460..489368
Genome map
AA seq 302 aa AA seqDB search
MRIGIDLGGTKTEVIALDDAGEQRFRHRLPTPREDYQQTIETIATLVDMAEQATGQTGSV
GIGIPGSLSPYTGVVKNANSTWLNGQPFDSDVSRRLKRAVRLANDANCLAVSEAVDGAAA
GAQTVFAVIIGTGCGAGVALNGRTHIGGNGTAGEWGHNPLPWMDDDELRYREEIPCYCGK
QGCIETFISGTGFATDYQHLSGNALKGDEIIRLVDAQDAVAELALSRYELRLAKALSHVV
NILDPDVIVLGGGMSNVERLYKTVPSLMKSFVFGGECETPVRKARHGDSSGVRGAAWLWP
LA
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtattggtatcgatttaggcggcacaaaaacggaagtcattgcgcttgatgatgca
ggagagcagcggtttcgccatcgtctgcctacgccgcgggaggattatcagcaaacgata
gaaaccatcgctacgctggtcgacatggcggaacaggcgaccggccagaccggtagcgtt
ggcattggcattcccggttctctctcgccttacaccggcgtggtaaaaaacgctaactct
acgtggcttaacggccagccgttcgatagcgatgtgagccgtcgtctgaagcgtgcagtg
cggttagccaacgatgccaattgcctggcggtatcagaggcggtagatggcgctgcggcg
ggggcgcaaacggtgtttgcggtgattatcggtaccgggtgcggcgcgggcgtagcgcta
aatggccggacgcacatcggcggcaacggtacggcaggcgaatggggccacaatccgttg
ccgtggatggatgacgatgagttgcgttaccgcgaagaaattccctgttattgcggtaaa
caaggctgtatcgaaacctttatttccggtacgggatttgccacggattaccagcatttg
agcggtaacgcgctaaaaggcgatgagattattcgtctggtcgacgcgcaggacgccgtg
gcggaactggcgttaagccgttatgagctacggctggcgaaagcattatctcatgtcgtg
aatattctggatccggatgtcattgtgctgggcggcggtatgagcaatgttgagcgcctg
tacaagacggttccgtcgctgatgaaatcgtttgtttttggcggcgagtgcgagacgccg
gtacgtaaggcgcggcatggcgattcaagcggcgtgcgcggcgcggcctggctgtggccg
ctggcgtaa

DBGET integrated database retrieval system