KEGG   Salmonella enterica subsp. enterica serovar Choleraesuis: SC0547Help
Entry
SC0547            CDS       T00240                                 

Gene name
tesA
Definition
multifunctional acyl-CoA thioesterase I/protease I/lysophospholipase L1
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
sec  Salmonella enterica subsp. enterica serovar Choleraesuis
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:sec01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(610211..610858)
Genome map
AA seq 215 aa AA seqDB search
MLTLTDGLPETMNFNTVFRWHLPFLFLILLTFRAAAADTLLILGDSLSAGYRMAASAAWP
SLLNDKWQNKTSVVNASISGDTSQQGLARLPALLQQHHPRWVVVELGGNDGLRGFAPAQT
EQTLRKIIQTVKAADAQPLLMQIHLPANYGRRYNESFSAIYPKLAKKFDIPLLPFFMEEV
YLKPQWMQDDGIHPNRDAQPFIADWMAKQLTPFLS
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgctcaccctgaccgacggacttcctgagacgatgaacttcaacactgttttccgctgg
catttgcccttcctgtttttgatcctgttaactttccgtgccgccgccgcagacacctta
ttaattctgggcgatagcctcagcgccggttaccgtatggccgccagcgcggcatggccg
tcgctccttaatgataaatggcaaaacaaaacgtcggtcgttaatgccagtataagcgga
gatacctcgcagcagggactggcgcgtttgccggcgctgttgcaacagcatcacccgcgc
tgggtagtggtggaacttggcggcaacgatggcctacgcggttttgcgcctgcgcaaacc
gaacagacgctacgtaaaatcattcagacggtgaaagccgccgatgcccaaccgttactg
atgcaaattcatctgcccgctaactacggtcgccgttataatgaatcctttagcgccatt
tatcctaagctcgccaaaaagttcgatattcctctgttaccgttttttatggaggaggta
tatctgaaaccgcagtggatgcaggatgacggcattcatcccaaccgcgacgcccagccg
tttattgccgactggatggcgaagcagttgaccccttttctctcctga

DBGET integrated database retrieval system