KEGG   Salmonella enterica subsp. enterica serovar Choleraesuis: SC0770Help
Entry
SC0770            CDS       T00240                                 

Gene name
gpmA
Definition
phosphoglyceromutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sec  Salmonella enterica subsp. enterica serovar Choleraesuis
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sec00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SC0770 (gpmA)
   01230 Biosynthesis of amino acids
    SC0770 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SC0770 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    SC0770 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SC0770 (gpmA)
Enzymes [BR:sec01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SC0770 (gpmA)
Exosome [BR:sec04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SC0770 (gpmA)
  Exosomal proteins of melanoma cells
   SC0770 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(865001..865753)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGFSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNDTILPRMKSGERVI
IAAHGNSLRALVKYLDNMSEDEILELNIPTGVPLVYEFDENFKPIKHYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggtacgtcacggtgaaagtcaatggaacaaagagaac
cgtttcaccggctggtatgatgttgacctgtctgaaaaaggcgtaagcgaagcaaaagca
gcaggtaaactgctaaaagaagaaggtttcagctttgattttgcctacacttccgtactg
aaacgcgctatccatacgctgtggaacgtactggatgaactggatcaggcgtggctgccg
gtggaaaaatcctggaaactcaacgaacgtcactatggcgcgttgcaggggctgaataaa
gcggaaacggccgaaaaatatggtgacgagcaggttaagcagtggcgccgcggttttgcc
gtaacgccgccggaactgaccaaagatgatgagcgttatccgggtcacgatccacgttat
gccaaactgagcgagaaagagctgccgttgaccgaaagtctggcgctgaccatcgaccgc
gttattccttactggaacgacaccatcctgccgcgtatgaagagcggtgagcgcgtgatc
atcgccgctcacggtaactcattgcgtgcgctggtgaaatacctggataacatgagtgaa
gatgagattcttgaattaaacatcccgaccggcgtgccgctggtgtatgagttcgacgaa
aacttcaagccgatcaaacattactatctgggtaacgctgacgagatcgctgcgaaagcg
gctgccgtggcgaatcagggtaaagcgaagtaa

DBGET integrated database retrieval system