KEGG   Salmonella enterica subsp. enterica serovar Choleraesuis: SC1903Help
Entry
SC1903            CDS       T00240                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
sec  Salmonella enterica subsp. enterica serovar Choleraesuis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sec00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SC1903 (ruvA)
Enzymes [BR:sec01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SC1903 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2012648..2013259)
Genome map
AA seq 203 aa AA seqDB search
MIGRLRGIILEKQPPIVLLETGGVGYEVHMPMTCFYELPEAGQEAIVFTHFVVREDAQLL
YGFNNKQERTLFKELIKTNGVGPKLALAILSGMSAQQFVNAVEREELGALVKLPGIGKKT
AERLIVEMKDRFKGLHGDLFTPAVDLVLTSPASPTSEDAEQEAVAALVALGYKPQEASRM
VNKIARPDASSETLIRDALRAAL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgataggcagactcagaggcattattctcgaaaaacaacccccgatcgtgctgctggag
acagggggcgtaggctatgaagtacatatgcctatgacctgcttttacgagctgccggag
gccgggcaggaggcaatcgtcttcacccactttgtggtgcgtgaagatgcgcagttgctg
tacggattcaacaataagcaagagcgcacgctgtttaaagagctaattaaaacgaatggc
gtcgggcctaagctggcgctggcgattctctccggcatgtcggcgcagcagtttgtgaat
gcggttgagcgcgaagagcttggcgcactggtgaagctgccgggtatcggcaagaaaacc
gccgaaaggctgattgtcgaaatgaaagaccgctttaaagggctacatggcgatctcttt
acgccagcggtcgatctggtattgacatcgccggccagcccaacctcggaagatgcagaa
caagaagcagttgctgcgctggtggcgctgggttataaaccgcaagaagccagtcggatg
gtaaacaagatcgcccgtccggatgcaagcagtgaaacactgattcgcgacgcgttacgc
gccgcgttatga

DBGET integrated database retrieval system