KEGG   Salmonella enterica subsp. enterica serovar Choleraesuis: SC2614Help
Entry
SC2614            CDS       T00240                                 

Gene name
lycV
Definition
Gifsy-2 prophage lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
sec  Salmonella enterica subsp. enterica serovar Choleraesuis
Brite
Enzymes [BR:sec01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     SC2614 (lycV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2775975..2776427)
Genome map
AA seq 150 aa AA seqDB search
MMRISEKGITLIKEFEGCSLTAYPDPGTGGDPWTIGYGWTHSVDGKPVKPGMMIDEATAE
RLLNTGLVGYENDVSRLVKVKLTQGQFDALVSFAYNLGARTLSSSTLLRKLNAGDYAGAA
DEFLRWNKAGGKVLNGLTRRREAERALFLS
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgatgagaatcagtgaaaaaggcattaccctaatcaaagagtttgaaggttgtagcctg
acagcttatccggacccgggaacggggggagatccctggacgattggttatggctggacc
cactctgttgacggtaagccagttaagcccggaatgatgattgacgaggctactgccgag
cgcttgcttaacactggtttagtcggttatgaaaatgatgtgtccagactggttaaggtc
aagttgacgcaaggccagtttgatgcgctggtgtcgttcgcgtacaacctcggcgcccgg
acattatcctcatcaactctgctgcggaagctaaacgctggtgattacgctggcgccgct
gatgagttcctgcgctggaataaggctggtggcaaagtactgaacgggcttacccgtcgg
cgtgaggcggagcgtgctctgttcctgtcatga

DBGET integrated database retrieval system