KEGG   Salmonella enterica subsp. enterica serovar Choleraesuis: SC3529Help
Entry
SC3529            CDS       T00240                                 

Definition
hypothetical protein
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
sec  Salmonella enterica subsp. enterica serovar Choleraesuis
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sec00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SC3529
   00051 Fructose and mannose metabolism
    SC3529
Enzymes [BR:sec01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     SC3529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3725471..3726424)
Genome map
AA seq 317 aa AA seqDB search
MKFSSRINSFRSRPELFNADNKMDTCDLITRMGNVDGLTHIELNYPDHFIGQDKKIIKQC
ITDNGLKVSGIALRYNKDFIDGEFTNPDSVLRDKAIETTLEAAEVCKFLGGTTVTLWFGY
DGYDYPFQQDYFRAYELLVNALRKVTSAHPDLQFSFEYKPYEPRTFSYISDVSSTLMLID
DVGNDNLGITLDFCHMIMKKENPAFSLFQSARKNRLVGFHLNDGYGHFDDGLMLGSVHLL
QTLEYIYYAKRVNFNGLIYFDTFPSREDPVAECALNIRMYKALSDFIDQLSIPEIEAMIK
SQDALKVQGMLLSMIAK
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaaattttcttcgcgaattaattctttccgctcaagacctgaattatttaatgcagat
aataagatggatacatgtgatcttattacaagaatgggcaatgtagatggattgacgcat
atagagctaaactatcctgatcattttattggacaggataaaaaaatcattaaacaatgt
attacagataacggattgaaagttagcggcattgcactacgttacaataaagattttatt
gatggtgaatttactaacccagattcggttcttcgcgataaagcgattgagacaacgttg
gaagctgctgaagtttgtaagttcctggggggcactactgtaacattatggtttggctat
gacggttatgattacccatttcaacaagactattttcgagcgtatgaattgctggtaaat
gccttacgtaaggtgacaagtgctcatccagatcttcagtttagttttgaatacaagcct
tatgaaccacggaccttttcttatattagtgatgtttcctcaaccctaatgttaattgat
gatgtcggtaacgataacttggggattacacttgatttctgccatatgataatgaaaaag
gaaaacccagcattttcattattccagtcagcacgtaaaaatagacttgtaggcttccat
ttaaatgatggatatggtcatttcgatgatggtttaatgttaggttcagtccatctgtta
cagactcttgaatatatttactatgctaaacgcgttaatttcaatggattgatttatttt
gatactttccctagccgcgaggatccagttgcagaatgtgcgctgaatattcgaatgtat
aaagcactttcagactttatagatcaactcagtattcctgagatagaagcgatgatcaaa
agccaggatgcactaaaagtacagggtatgttgttaagcatgatagccaaataa

DBGET integrated database retrieval system