KEGG   Salmonella enterica subsp. enterica serovar Choleraesuis: SC3531Help
Entry
SC3531            CDS       T00240                                 

Gene name
rbsK
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sec  Salmonella enterica subsp. enterica serovar Choleraesuis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sec00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SC3531 (rbsK)
Enzymes [BR:sec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SC3531 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3727648..3728466
Genome map
AA seq 272 aa AA seqDB search
MLMPGGKGANQAVQCSKLGLNVSMVGCVGNDIYGEHLINALHENNVSVANVLKRGTTTGI
GIVQILESGDYCSTIIKGANYLLNENDISDNLFDGKPLVILQSEIPSHIVEYVIKVASMY
QCKVILNNAPARSIAPSTLSSVDYLVVNETEASFMAGSEVSSIDDAHSCAAKLHKMVRSN
VIITLGEKGAVLSSDESTMHFPAVFCPEVIDTTGAGDSFIGGIAYCLVNNIPLTKAIPFA
AEISMCSIQKYGGQSSFPMLADVAHALDYSDL
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgttaatgcctggtggtaaaggtgctaatcaagcggtacagtgctcaaaactgggattg
aacgtgagtatggtggggtgtgtagggaacgacatttatggcgagcacctcattaatgcc
ctacatgaaaataatgtctccgttgctaacgtattgaaacggggaaccaccacaggtatc
ggcatcgtacagatccttgagtccggtgattattgtagcaccattattaaaggagctaac
tatctgttaaacgaaaatgatattagcgataatttatttgatggaaaaccgctggtgatt
ctgcaatcagaaataccttcacatatcgttgaatatgttattaaagtcgccagtatgtat
caatgcaaagttatacttaataatgcgccagccagaagtatagcgccatcaacattaagt
tctgttgattacctggtcgttaatgaaacagaagccagctttatggcaggtagtgaagtt
tcatcaattgatgacgctcattcttgtgccgctaagttacataaaatggttaggagtaat
gtcattataacattaggggaaaaaggcgcggtattatcctcggatgagtcaaccatgcac
tttccagcggtcttttgccctgaagttattgatactacaggtgctggcgattcatttatc
ggcggcattgcctactgcctggttaataatatccctttaacaaaggccatcccttttgct
gctgaaataagcatgtgctcaattcaaaagtatggtggacaaagctcttttccaatgctt
gcggatgttgctcatgccttagactattccgacctgtaa

DBGET integrated database retrieval system