KEGG   Salmonella enterica subsp. enterica serovar Choleraesuis: SC3695Help
Entry
SC3695            CDS       T00240                                 

Gene name
bglA
Definition
glycosyl hydrolase family protein
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
sec  Salmonella enterica subsp. enterica serovar Choleraesuis
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:sec00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SC3695 (bglA)
Enzymes [BR:sec01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SC3695 (bglA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3914387..3915769
Genome map
AA seq 460 aa AA seqDB search
MRYRFPDNFWWGSACSALQTEGDSLNGGKSQTTWDVWFERQPDRFHQGVGPAETSTFYRH
WKQDIALLKQLKHNSFRTSLSWARLIPDGVGEVNPQAVSFYNHVIDELLAQGITPFITLF
HFDMPMVMQEKGGWENRDVVEAFGRYAQTCFTLFGDRVKHWFTFNEPIVPVEGGYLYDFH
YPNVVDFKRAATVAYHTVLAHSTALRAWRAGRYDGEIGVVLNLTPSYPRSQHPADVQAAH
HADLLFNRSFLDPVLKGEYPTDLVALLKTYDQLPACQPGDRQLIADGKIDLLGINYYQPR
RVKCRDTAVNPQAPFMPEWLFDYYDMPGRKMNPYRGWEIYAPGIYDIITNLRDNYGNPRC
FISENGMGVENEQRFVQAGQIHDDYRIDFISEHLKWLHKGISEGCHCLGYHMWTFIDNWS
WLNGYKNRYGFVQLDLATQTRTVKKSGEWFAATAEHNGFD
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgcgataccgttttcccgataacttctggtggggcagcgcctgctcagcgttgcaaacc
gaaggggatagtctgaatggcggtaaaagccagaccacgtgggatgtgtggttcgagcgc
cagcctgatcgttttcaccaaggcgtcggtccagcggaaacctcaacgttctatcgccac
tggaagcaagacatcgcgctactgaaacagttaaaacataacagttttcgcacctcgcta
agctgggcgcggctcattccagacggcgtaggcgaggtgaatccacaagcggtgagcttc
tacaatcacgtcatcgacgagctactggcgcagggcatcacgccgtttattacgctgttc
cattttgatatgccgatggtcatgcaggagaaaggcggctgggaaaatcgcgacgtcgta
gaggcgtttggtcggtacgcgcaaacgtgttttaccttgtttggcgaccgcgtgaagcac
tggtttacctttaacgagccgattgtgccggtggaaggcggctatttgtacgacttccac
tatcccaatgtggtggattttaaacgtgcagccaccgtggcgtaccataccgtgctggcg
cactcgaccgccttgcgcgcctggcgcgccggacgctacgacggtgaaatcggcgtggtg
ctgaatctgacgccgtcctacccacgctcgcagcatcccgccgatgtgcaagccgcgcat
catgcggatctgttattcaaccgcagttttcttgacccggtattaaagggagaatacccg
acggacttggtggcgctgctgaaaacctatgaccagttgcctgcctgtcagccaggcgac
cgtcagcttattgccgacggcaaaatcgatttactggggattaactattatcagccgcgc
cgcgtgaaatgccgtgatacggcggtgaatccgcaagcgccgtttatgccggaatggtta
tttgactattacgacatgccggggcgcaagatgaacccttaccgcggctgggaaatttac
gcgccaggaatttacgacatcatcaccaacctgcgggataattacggcaatccgcgctgt
tttatctccgaaaacgggatgggcgttgagaacgagcagcgttttgtgcaagcgggacag
attcacgatgattaccggattgactttatctctgagcatcttaaatggctgcataaaggc
attagcgagggctgtcactgtcttggctaccacatgtggacctttatcgataactggtca
tggctgaacggctataaaaatcgctatggttttgtacaactggatttagccacccaaacg
cgcacggtgaaaaaaagcggagaatggtttgccgccaccgcagagcataacggttttgat
taa

DBGET integrated database retrieval system