KEGG   Salmonella enterica subsp. enterica serovar Choleraesuis: SC3774Help
Entry
SC3774            CDS       T00240                                 

Gene name
glmS
Definition
(RefSeq) glucosamine--fructose-6-phosphate aminotransferase (EC:2.6.1.16)
  KO
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
sec  Salmonella enterica subsp. enterica serovar Choleraesuis
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Insulin resistance
Brite
KEGG Orthology (KO) [BR:sec00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SC3774 (glmS)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SC3774 (glmS)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    SC3774 (glmS)
Enzymes [BR:sec01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.16  glutamine---fructose-6-phosphate transaminase (isomerizing)
     SC3774 (glmS)
Peptidases [BR:sec01002]
 Cysteine Peptidases
  Family C44
   SC3774 (glmS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4004093..4005922)
Genome map
AA seq 609 aa AA seqDB search
MCGIVGAIAQRDVAEILLEGLRRLEYRGYDSAGLAVVDAEGHMTRLRRLGKVQMLAQAAE
EHPLHGGTGIAHTRWATHGEPSEANAHPHVSEHIVVVHNGIIENHEPLREALKARGYTFV
SETDTEVIAHLVNWELKQGGTLREAVLRAIPQLRGAYGTVIMDTRHPDTLLAARSGSPLV
IGLGMGENFIASDQLALLPVTRRFIFLEEGDIAEITRRSVNIFDNTGAEVKRQDIESNLQ
YDAGDKGIYRHYMQKEIYEQPNAIKNTLTGRISHGQVDLSELGPNADELLSKVEHIQILA
CGTSYNSGMVSRYWFESLAGIPCDVEIASEFRYRKSAVRRNSLMITLSQSGETADTLAGL
RLSKELGYLGSLAICNVPGSSLVRESDLALMTNAGTEIGVASTKAFTTQLTVLLMLVAKL
ARLKGLDTSIEHDIVHGLQALPSRIEQMLSQDKRIEALAEDFSDKHHALFLGRGDQYPIA
LEGALKLKEISYIHAEAYAAGELKHGPLALIDADMPVIVVAPNNELLEKLKSNIEEVRAR
GGQLYVFADQDAGFVSNDNMHIIEMPHVEEVIAPIFYTVPLQLLAYHVALIKGTDVDQPR
NLAKSVTVE
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaattgttggcgctatcgcgcagcgtgatgtagctgaaatccttctcgaaggt
ttacgtcgtctggaataccgcggatatgactctgccggtctggccgtggttgatgcagaa
ggtcatatgacccgcctgcgtcgcctcggtaaagtccaaatgctggctcaggcagcggaa
gaacatcctctgcatggcggcaccggtattgctcacactcgttgggcgacgcacggtgaa
ccttcagaagctaacgcgcatccgcatgtttctgaacacattgtggtggtgcataacggc
atcatcgaaaaccatgaaccgctgcgtgaagcgttaaaagcgcgtggctataccttcgtt
tctgaaaccgacaccgaagtgattgcacacctggtaaactgggaactgaaacagggcggt
actctgcgtgaggctgttctgcgtgctatcccgcaactgcgtggcgcatatggtacggta
attatggatacccgtcacccggataccctactggcggcacgttctggtagcccgctggtg
attggcctgggtatgggcgaaaactttatcgcttctgaccagctggcgctgttgccagtg
actcgtcgctttatcttccttgaagagggcgatatcgctgaaatcactcgccgttcggta
aatatcttcgataacaccggcgcggaagtaaaacgtcaggatatcgaatccaatctgcaa
tatgacgcgggcgataaaggtatttaccgccactacatgcagaaagagatctacgaacag
ccgaacgcgatcaaaaacacccttaccgggcgcatcagccacggtcaggtggatttaagc
gagctgggaccgaacgccgatgaactgctgtcgaaggttgagcatattcagatcctcgcc
tgcggtacgtcttacaactccggtatggtttcccgttactggtttgaatcgctggcaggt
attccgtgcgacgttgaaatcgcctctgaattccgctatcgcaaatctgccgtgcgtcgt
aacagcctgatgattaccctgtcacagtctggcgaaaccgcagataccctggctggcctg
cgtctgtcgaaagagctgggatatttgggctctctggccatttgtaacgtgccgggatct
tcgctggtgcgtgaatccgatctggcgctgatgaccaacgcgggtacggaaattggcgta
gcatctaccaaagccttcaccacccagttaaccgtgctgttgatgctggtggcgaaactg
gcgcgtctgaaaggtctggatacgtccattgagcatgatatcgtgcatggcctacaggcg
ctgccgagccgtattgagcagatgctgtcgcaggacaaacgtatcgaagccctggcggaa
gatttctctgacaaacaccatgcgctgttcctggggcgtggcgatcaatatccgattgcg
ctcgaaggcgcgctgaagctgaaagagatctcttacattcacgcggaagcctatgctgca
ggcgagctgaaacacgggccgttggcgctgattgacgccgatatgccggtgattgtggtg
gcgccgaacaacgaactgctggagaaactgaaatccaacatcgaagaagttcgcgcacgt
ggcggtcagttgtacgtcttcgccgatcaggatgcgggtttcgtcagcaacgacaacatg
cacatcatcgagatgccgcatgtggaagaggtcattgcgcctatcttctacaccgttccg
ctgcaactgctggcgtatcacgtggcgctgattaaaggcaccgacgttgaccagccgcgt
aacctggcgaaatcggttaccgtagagtaa

DBGET integrated database retrieval system