KEGG   Salmonella enterica subsp. enterica serovar Choleraesuis: SC3774Help
Entry
SC3774            CDS       T00240                                 

Gene name
glmS
Definition
glucosamine--fructose-6-phosphate aminotransferase (EC:2.6.1.16)
Orthology
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
sec  Salmonella enterica subsp. enterica serovar Choleraesuis
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sec00520]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:sec00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(4004093..4005922)
Genome map
AA seq 609 aa AA seqDB search
MCGIVGAIAQRDVAEILLEGLRRLEYRGYDSAGLAVVDAEGHMTRLRRLGKVQMLAQAAE
EHPLHGGTGIAHTRWATHGEPSEANAHPHVSEHIVVVHNGIIENHEPLREALKARGYTFV
SETDTEVIAHLVNWELKQGGTLREAVLRAIPQLRGAYGTVIMDTRHPDTLLAARSGSPLV
IGLGMGENFIASDQLALLPVTRRFIFLEEGDIAEITRRSVNIFDNTGAEVKRQDIESNLQ
YDAGDKGIYRHYMQKEIYEQPNAIKNTLTGRISHGQVDLSELGPNADELLSKVEHIQILA
CGTSYNSGMVSRYWFESLAGIPCDVEIASEFRYRKSAVRRNSLMITLSQSGETADTLAGL
RLSKELGYLGSLAICNVPGSSLVRESDLALMTNAGTEIGVASTKAFTTQLTVLLMLVAKL
ARLKGLDTSIEHDIVHGLQALPSRIEQMLSQDKRIEALAEDFSDKHHALFLGRGDQYPIA
LEGALKLKEISYIHAEAYAAGELKHGPLALIDADMPVIVVAPNNELLEKLKSNIEEVRAR
GGQLYVFADQDAGFVSNDNMHIIEMPHVEEVIAPIFYTVPLQLLAYHVALIKGTDVDQPR
NLAKSVTVE
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaattgttggcgctatcgcgcagcgtgatgtagctgaaatccttctcgaaggt
ttacgtcgtctggaataccgcggatatgactctgccggtctggccgtggttgatgcagaa
ggtcatatgacccgcctgcgtcgcctcggtaaagtccaaatgctggctcaggcagcggaa
gaacatcctctgcatggcggcaccggtattgctcacactcgttgggcgacgcacggtgaa
ccttcagaagctaacgcgcatccgcatgtttctgaacacattgtggtggtgcataacggc
atcatcgaaaaccatgaaccgctgcgtgaagcgttaaaagcgcgtggctataccttcgtt
tctgaaaccgacaccgaagtgattgcacacctggtaaactgggaactgaaacagggcggt
actctgcgtgaggctgttctgcgtgctatcccgcaactgcgtggcgcatatggtacggta
attatggatacccgtcacccggataccctactggcggcacgttctggtagcccgctggtg
attggcctgggtatgggcgaaaactttatcgcttctgaccagctggcgctgttgccagtg
actcgtcgctttatcttccttgaagagggcgatatcgctgaaatcactcgccgttcggta
aatatcttcgataacaccggcgcggaagtaaaacgtcaggatatcgaatccaatctgcaa
tatgacgcgggcgataaaggtatttaccgccactacatgcagaaagagatctacgaacag
ccgaacgcgatcaaaaacacccttaccgggcgcatcagccacggtcaggtggatttaagc
gagctgggaccgaacgccgatgaactgctgtcgaaggttgagcatattcagatcctcgcc
tgcggtacgtcttacaactccggtatggtttcccgttactggtttgaatcgctggcaggt
attccgtgcgacgttgaaatcgcctctgaattccgctatcgcaaatctgccgtgcgtcgt
aacagcctgatgattaccctgtcacagtctggcgaaaccgcagataccctggctggcctg
cgtctgtcgaaagagctgggatatttgggctctctggccatttgtaacgtgccgggatct
tcgctggtgcgtgaatccgatctggcgctgatgaccaacgcgggtacggaaattggcgta
gcatctaccaaagccttcaccacccagttaaccgtgctgttgatgctggtggcgaaactg
gcgcgtctgaaaggtctggatacgtccattgagcatgatatcgtgcatggcctacaggcg
ctgccgagccgtattgagcagatgctgtcgcaggacaaacgtatcgaagccctggcggaa
gatttctctgacaaacaccatgcgctgttcctggggcgtggcgatcaatatccgattgcg
ctcgaaggcgcgctgaagctgaaagagatctcttacattcacgcggaagcctatgctgca
ggcgagctgaaacacgggccgttggcgctgattgacgccgatatgccggtgattgtggtg
gcgccgaacaacgaactgctggagaaactgaaatccaacatcgaagaagttcgcgcacgt
ggcggtcagttgtacgtcttcgccgatcaggatgcgggtttcgtcagcaacgacaacatg
cacatcatcgagatgccgcatgtggaagaggtcattgcgcctatcttctacaccgttccg
ctgcaactgctggcgtatcacgtggcgctgattaaaggcaccgacgttgaccagccgcgt
aacctggcgaaatcggttaccgtagagtaa

DBGET integrated database retrieval system