KEGG   Salmonella enterica subsp. enterica serovar Choleraesuis: SC3934Help
Entry
SC3934            CDS       T00240                                 

Gene name
adh2
Definition
iron-containing alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
sec  Salmonella enterica subsp. enterica serovar Choleraesuis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sec00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SC3934 (adh2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SC3934 (adh2)
  Lipid metabolism
   00071 Fatty acid degradation
    SC3934 (adh2)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SC3934 (adh2)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SC3934 (adh2)
   00626 Naphthalene degradation
    SC3934 (adh2)
Enzymes [BR:sec01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SC3934 (adh2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(4186849..4187997)
Genome map
AA seq 382 aa AA seqDB search
MSFMLALPKISLHGAGAIADMVNLVANKQWGKALIVTDGQLVKLGLLDSLFSALDKHQMS
YHLFDEVFPNPTEELVQKGFAAYQSAECDYIIAFGGGSPIDTAKAVKILTANPGPSTAYS
GVGKVKNAGVPLVAINTTAGTAAEMTSNAVIIDSARKVKEVIIDPNIIPDIAVDDASVML
EIPASVTAATGMDALTHAVEAYVSVGAHPLTDANALEAIRLINVWLPKAVDDGHNLEARE
QMAFGQYLAGMAFNSAGLGLVHALAHQPGATHNLPHGVCNAILLPIVENFNRPNAVERFA
RIAQAMGVETRGMSDEAASQEAINAIRTLSKRVGIPEGFSKLGVTKEDIEGWLDKALADP
CAPCNARTASRDEVRGLYLEAL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagctttatgttggcactgccaaaaattagcctgcatggcgctggagcgattgccgat
atggtgaacctcgtggcgaataagcaatggggcaaagcgctgatcgttaccgatggtcaa
ctggtaaagctgggcctgctggatagcctgtttagcgcactggataaacatcaaatgtct
taccacctgtttgatgaggtgttcccaaacccgacagaagagctggtgcagaaaggtttt
gcggcatatcagagcgcagaatgtgactacattatcgccttcggcggcggcagcccgatc
gataccgcaaaagcggtgaaaattctgaccgccaacccaggtccatctaccgcctactcc
ggcgtcggcaaagtgaaaaacgccggcgtaccgctggtagcgattaacactacggcaggt
accgcggcagagatgaccagcaacgcggtgattatcgactctgcccgtaaggtcaaagag
gtgattatcgacccgaacatcatcccggatattgccgtggatgacgccagcgttatgctg
gaaatccccgcttctgtgaccgccgcaaccggcatggatgccctgacccatgcggtggaa
gcctatgtctccgttggcgcgcatccgctcaccgacgctaacgcgctggaagcgattcgc
ttaatcaatgtgtggctaccgaaagcggttgacgatggccataacctcgaagcccgtgag
caaatggcattcggccagtacctggcgggtatggcgttcaacagcgccggtttggggctg
gttcacgcgctggcgcaccagccgggcgcaacccacaacctgccgcacggcgtctgcaac
gctatcctgctgccaattgtcgagaactttaaccgtccgaatgccgtcgagcgttttgcc
cgcatcgcacaggcgatgggcgtggagacgcgcggtatgtctgacgaagccgcaagtcag
gaagcgattaacgctatccgtacgctgagcaaacgcgtcggcattccagaaggtttcagc
aagctgggcgtcacaaaagaagatatcgaaggctggctggataaagccctcgccgacccg
tgcgcgccgtgtaacgcgcgcaccgccagccgcgatgaagttcgcgggctgtacctggag
gcgttatga

DBGET integrated database retrieval system