KEGG   Salmonella enterica subsp. enterica serovar Choleraesuis: SC4063Help
Entry
SC4063            CDS       T00240                                 

Gene name
aceA
Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
sec  Salmonella enterica subsp. enterica serovar Choleraesuis
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sec00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SC4063 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SC4063 (aceA)
Enzymes [BR:sec01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     SC4063 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4337021..4338325
Genome map
AA seq 434 aa AA seqDB search
MKTRTQQIEELQKEWTQPRWEGITRPYSAEEVVKLRGSVNPECTLAQLGAAKMWRLLHGE
AKKGYINSLGALTGGQALQQAKAGIEAIYLSGWQVAADANLASSMYPDQSLYPANSVPAV
VDRINNTFRRADQIQWASGIEPNDPRYVDYFLPIVADAEAGFGGVLNAFELMKSMIEAGA
AAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVMGVPTLVIARTDADAADL
ITSNCDPYDSSFITGERTSEGFYRTHAGIEQAISRGLAYAPYADLVWCETSTPDLELARR
FADAIHAKYPGKLLAYNCSPSFNWQKNLDDKTIASFQQQLSDMGYKYQFITLAGIHSMWF
NMFDLAHAYAQGEGMKHYVEKVQQPEFAAAKDGYTFVSHQQEVGTGYFDKVTTIIQGGAS
SVTALTGSTEESQF
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacccgtactcaacaaatcgaagaattacagaaagagtggacacaaccgcgctgg
gaaggcatcacccgcccgtacagtgcggaggaggtggtgaaattacgcggctcggttaac
ccggagtgcacgctggcgcagctcggcgccgcgaaaatgtggcggctgttgcacggtgaa
gcgaaaaaaggctatatcaacagccttggcgcgctgaccggtggtcaggcgttgcagcag
gcgaaagccggtattgaggcgatttatctttcaggctggcaggtggcggcagatgccaac
ctggcatccagcatgtatccggatcaatcgttgtacccggcaaactctgttccggcggta
gtggatcggatcaacaacactttccgtcgtgcagatcagatccagtgggcatccggtatt
gaacccaacgatccgcgctatgtggattacttcctgccgatcgttgctgatgcggaagcc
ggttttggcggcgttctgaatgccttcgaactgatgaaatcgatgattgaagccggtgca
gcggccgttcacttcgaagatcagctggcgtcggtgaagaaatgcggccatatgggcggc
aaggtgctggtccccacgcaggaggcgattcagaaactggttgctgcgcgtctggccgct
gatgtgatgggcgtcccgacgctggtgattgcgcgtaccgatgcggatgcggcagatctg
atcacctccaactgcgatccctatgacagcagttttattaccggcgaacgcaccagcgaa
ggtttctaccgcacccatgcgggcattgagcaggcgatcagccgcggtctggcgtatgcc
ccgtatgccgatctggtgtggtgcgaaacctctacgccggatctcgaactggcgcgtcgt
tttgccgatgctatccacgcgaagtatccgggcaaactgctggcctataactgttcacca
tccttcaactggcagaagaatctggacgacaagaccattgccagcttccagcagcagttg
tcggacatgggttacaaataccagtttattaccctggcgggcatccacagcatgtggttc
aacatgttcgacctggcgcatgcatacgcgcagggcgagggtatgaagcactatgttgag
aaggttcaacaacccgagttcgccgcggcgaaagacggctacacctttgtttcccaccag
caggaagtgggtactggttacttcgacaaagtcaccaccattattcagggcggcgcgtca
tccgttaccgcattaacgggttccaccgaagaatcgcagttttga

DBGET integrated database retrieval system