KEGG   Salmonella enterica subsp. enterica serovar Choleraesuis: SC4416Help
Entry
SC4416            CDS       T00240                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
sec  Salmonella enterica subsp. enterica serovar Choleraesuis
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sec00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SC4416 (deoA)
Enzymes [BR:sec01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     SC4416 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4724643..4725965
Genome map
AA seq 440 aa AA seqDB search
MFLAQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLT
MAMRDSGTVLDWKSLNLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLEAIPGFDIFPDDNRFREIIQDVGVAIIGQTSSLAPADKRFYATRDITATVDSI
PLITGSILAKKLAEGLDALVMDVKVGSGAFMPTYELSEALAEAIVGVANGAGVRTTALLT
DMNQVLASSAGNAVEVREAVQFLTGEYRNPRLFDVTMALCVEMLISGQLAKDDAEARTKL
QAVLDNGKAAEVFGRMVAAQKGPSDFVENYDKYLPTAMLSKAVYADTEGFISAMDTRALG
MAVVSMGGGRRQASDTIDYSVGFTDMARLGDSIDGQRPLAVIHAKDEASWQEAAKAVKAA
IILDDKAPVSTPSVYRRITE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtgtttctcgcacaagaaattattcgtaaaaagcgtgatggtcatgcgttgagtgacgaa
gaaattcgtttctttatcaatggtattcgtgacaatactatctctgaagggcagattgcc
gccctggcgatgaccatcttcttccacgatatgaccatgccggagcgtgtttcgctgacc
atggcgatgcgggattccggtactgtccttgactggaaaagcctgaatctcaatggcccg
attgtcgataagcattcgaccggcggcgtaggggacgtgacgtctctgatgttggggcca
atggtagcggcctgcggcggttatgtgccgatgatctccggtcgcggcctcggacatacc
ggcggtacgctcgacaaactggaagcgatcccgggcttcgatatcttcccggacgacaac
cgtttccgcgaaattattcaagacgtgggtgtggcgattattgggcaaaccagctcgctt
gcaccggcggacaaacgtttttacgccacccgcgatattaccgcgacggtggactctatt
ccgctgatcaccggctccatcctcgccaagaaactggccgaagggctggatgcgctggta
atggacgtaaaagtcggcagcggcgcgtttatgccaacctatgaactttctgaagccctt
gctgaagcgattgtcggcgtggcaaatggcgcgggagttcgcactacggcgttgttaacc
gatatgaaccaggtgctggcttcaagcgccggtaacgcggtggaagtgcgtgaagccgtg
cagttcctgaccggtgaataccgcaatccgcgcttgtttgacgttaccatggcgctatgc
gtggagatgctgatctccggtcagttggcgaaagacgacgccgaagcgcgtaccaaactg
caggcggtgctggataacggtaaagcggcagaagtctttggtcgtatggtggccgcgcag
aaagggccgagcgatttcgttgagaactacgataaatacctgccgaccgccatgttgagc
aaagcggtatatgctgataccgaagggtttatcagcgcaatggatacgcgtgcgctgggg
atggcggtcgtctcgatgggcggcggccgtcgtcaggcgtctgataccattgattacagc
gttggctttaccgacatggcccgtctgggcgacagcatcgacgggcagcgcccgctggcg
gtgattcatgccaaagacgaagccagttggcaggaagcggcgaaggccgtcaaagcggca
attatccttgacgataaagcgccagtaagcacaccttcggtctatcgtcgaattactgaa
tag

DBGET integrated database retrieval system