KEGG   Secondary endosymbiont of Ctenarytaina eucalypti: A359_00680Help
Entry
A359_00680        CDS       T02199                                 

Definition
2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sect  Secondary endosymbiont of Ctenarytaina eucalypti
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sect00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    A359_00680
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A359_00680
  Amino acid metabolism
   00310 Lysine degradation
    A359_00680
Enzymes [BR:sect01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     A359_00680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
110027..111211
Genome map
AA seq 394 aa AA seqDB search
MSNVDILVPDLLESISDATVVNWNKTPGEPVQRDEVLVELETDKVVLEVLSPEAGILEEV
LEDAGSTVTSRQVLGRLRRRDSTGQAQTEQLYTQKTAMVQGHQKILEAASHDTSCLTISQ
LIADHDLNAEVIKNSGINDDLTHEDVEKEVVREQSAPAPIGNRREKRVPMTRLRHRVSQR
LVEAKNSTAMLTTFNEVNMQPVMALRQQYGEAFEKRHGIRLGYMSFYIKAVLEALKRFPE
VNASIDGEDVVYRHYFDISIAVSTPRGLVTPVLKDIDMLGMAGIEKKIKQFALKGRNGTL
TVEELTGGSFTVTNGGTFGSLISTPIINPPQSAILGMHVIKDRPMAVGGKVVILPMMYLA
LSYDHRLIDGKESISFLVTVKDVLEDPIRLLLDV
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacgtagatattctggtgcctgacctgcttgaatcgatttcggatgctaccgtt
gttaattggaataaaacccccggtgaacccgtccagcgtgatgaggtgctggtcgagctt
gaaaccgataaggtggtgctagaagtgctgtcaccggaagctggtattctggaagaagtg
ttagaagatgcaggttcgactgttacctccaggcaagtgctggggcgtcttcgcaggaga
gatagtacaggccaggctcagaccgaacagctctatacccaaaaaaccgctatggttcag
ggccaccagaaaattctggaagcagcgagccatgacacgtcatgcctgaccatttcccag
ctcatcgccgatcatgatttgaatgccgaggtcataaaaaacagcggcataaatgacgat
ctcacccacgaagacgttgaaaaagaggtcgtcagggagcagagcgccccggcgccaatc
ggcaatcgtcgcgaaaaacgcgttccgatgacccgcctgcgtcatcgcgtatcccaacgt
ttagttgaagcgaaaaatagcaccgccatgctgactaccttcaatgaggtgaatatgcag
ccggtgatggctctacgtcagcagtacggtgaagcatttgaaaaacgccacggcatccgt
cttggatacatgtcattttatattaaggcggtattagaggcattaaaacgctttccggaa
gtcaatgcttccattgatggcgaagatgtggtttaccgacattattttgatatcagtatc
gcggtgtccaccccgcgaggtttggtcacgccagtgctaaaagatatcgacatgctaggg
atggcgggtattgagaaaaaaattaaacaattcgctcttaagggtcgcaacggcacacta
acagtcgaggaattgaccggtggtagctttacagttactaatggcgggacgttcggctca
ttgatatcgacacccatcatcaatccgcctcaaagcgcaattctgggcatgcatgtcatc
aaggatcggccaatggccgtaggaggtaaggtcgttattttgcctatgatgtatctagcg
ctctcttatgaccacaggctgatcgacggtaaagaatccataagctttttagtgacggtg
aaggatgtgctggaagacccgattcgactattgcttgacgtgtag

DBGET integrated database retrieval system