KEGG   Secondary endosymbiont of Ctenarytaina eucalypti: A359_01770Help
Entry
A359_01770        CDS       T02199                                 

Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sect  Secondary endosymbiont of Ctenarytaina eucalypti
Pathway
sect00040  Pentose and glucuronate interconversions
sect00052  Galactose metabolism
sect00500  Starch and sucrose metabolism
sect00520  Amino sugar and nucleotide sugar metabolism
sect01100  Metabolic pathways
sect01130  Biosynthesis of antibiotics
Module
sect_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sect00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    A359_01770
   00052 Galactose metabolism
    A359_01770
   00500 Starch and sucrose metabolism
    A359_01770
   00520 Amino sugar and nucleotide sugar metabolism
    A359_01770
Enzymes [BR:sect01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     A359_01770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AFP84579
UniProt: J3Z2Y9
Position
282498..283337
Genome map
AA seq 279 aa AA seqDB search
MLPATKAIPKEMLPLVDKPLIQYVVNECIAAGLNEIILVTHSSKNSIENHFDTSFELEAM
LEKRVKRQLLEEIQAICPPHVTIMQVRQGLSQGLGHAVLCAHPLVRNEPVAVILPDVIID
EYESNLQTENLAGMLKRFEDTGRSQILVEAVNDVSSYGVVDCHGKNLKPGESVKMIGVVE
KPAAGQAPSNLSVVGRYVLSVDIWALLKKTQPGSGNEIQLTDAIAMLIETEAVEAYRLIG
LSHDCGNKLGYMKTFVEYGLRHKIFGKEFKTWLKVSIKE
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgttgccggcaacaaaagcaatcccgaaggaaatgctgcctctggtagataagcctctg
attcagtacgtggttaatgaatgtatcgcagctggtctcaatgagatcatactggtaact
cactcgtctaaaaattctattgaaaatcattttgatactagtttcgaactagaagcgatg
ctggaaaagcgcgttaaacgtcaactattagaggagattcaagcaatttgtccgcctcat
gtaaccattatgcaagtgcgtcagggcctctcccagggtctagggcatgcggtcttatgc
gcacacccgctagtgcgaaatgagccggttgcggtgatcttgcccgacgtgattatcgat
gaatatgagtccaacttgcagactgaaaatttagcggggatgctaaaacgatttgaagat
accggtcgcagtcaaattttagttgaggcagtgaatgatgtcagcagctatggcgtagtg
gattgccacgggaagaacctcaagccgggtgagagcgtaaagatgattggcgtcgtcgaa
aagccagcagctggacaagcgccatctaatttatcggtagttggtcgttatgtgctgtct
gtcgatatttgggcgctactgaaaaaaacacagcctggttccggaaatgaaattcaactg
acggatgctattgcgatgctaatagaaacagaagccgttgaagcgtaccgcctgataggt
ctcagccatgattgcggcaataagttgggctatatgaaaacgttcgttgagtatggtctt
cgtcataaaatatttggtaaagaatttaaaacttggttaaaagtttctatcaaagaataa

DBGET integrated database retrieval system