KEGG   Secondary endosymbiont of Ctenarytaina eucalypti: A359_02150Help
Entry
A359_02150        CDS       T02199                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
sect  Secondary endosymbiont of Ctenarytaina eucalypti
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sect00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    A359_02150
Enzymes [BR:sect01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     A359_02150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(342299..342964)
Genome map
AA seq 221 aa AA seqDB search
MVILTKEALQVREALMICGLETPLRGEVQDKAVRKRLIAEHMQAIMTLLNLDWTDDSLAK
TPNRIAKMYVEELFAGLDYVNFPKITFIKNKMNVDEMVTVHDITLTSTCEHHFLMIDGKA
TVSYIPKNFVIGLSKINRIVQFFSQRPQLQERLTQQILLTLQTLLGINSVAVSIDAVHYC
VKAQGIRHGDSTTTTTSLGGLFKSSNNIRQEFLRAATRHKG
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggtaatactgacaaaagaggccttgcaagtccgcgaggctctgatgatttgtggactc
gaaactccacttcggggagaagtacaagacaaggcggtgcgtaaacgtctaattgcagag
catatgcaagcgatcatgacgctactcaaccttgactggaccgatgatagtctggcaaaa
acccctaatcgcatcgccaagatgtacgtagaagaacttttcgccggcctggattatgtt
aattttcctaaaattacatttatcaaaaacaagatgaatgtagatgaaatggttacggtg
catgacattactttaacgagcacctgcgagcatcactttttgatgatcgatggcaaagca
acagtatcttatattcctaaaaactttgtgatcgggctgtcgaagatcaatcgtatcgta
caatttttttcccaacgaccgcaattgcaggagcggttgacgcagcagattttgctcacg
ctacagacgcttcttggcatcaatagcgtggcagtttccattgatgccgtgcactattgc
gtcaaagcgcaagggatccgccatggcgacagcacaaccactaccacatcgctgggcgga
ctctttaaatctagtaacaatattcgccaggaatttttgcgtgcggccactcgtcacaag
ggctaa

DBGET integrated database retrieval system