KEGG   Secondary endosymbiont of Ctenarytaina eucalypti: A359_02900Help
Entry
A359_02900        CDS       T02199                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
sect  Secondary endosymbiont of Ctenarytaina eucalypti
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sect00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(453951..454538)
Genome map
AA seq 195 aa AA seqDB search
MRTAAGKNMLTTFADDQLVLTRSRCRAAQSGQCLIERVWLGIGSNLSRPVQQVSAALEAL
DSLPKTRLVDVSSYYRSRPLGPKDQPDFLNAVVALDTTLTPDTLLSYTQAIELCQGRARK
TSRFGPRTLDLDILLFGDRIIGTPRLTVPHYDMHNREFMLYPLFESEPELLLPGGVALTE
RLRQVPRNGLRYWEK
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
gtgcgaaccgccgcggggaaaaatatgctgactacgtttgctgatgaccagttagttctt
actcgttcgcgctgccgggcggcccaatcaggacagtgcctcatagagcgtgtctggctg
gggataggaagcaatctttctaggccggttcagcaggtaagcgctgctctcgaggcgctc
gacagcctgccgaaaacacgtcttgttgacgtttcctcttactaccgcagtcgccctctc
ggcccgaaggatcagcccgatttcttgaacgccgtcgtagcattagacaccaccctcaca
cctgacacactactaagttacactcaggccattgaattatgtcagggacgtgcccggaaa
acgtctcgtttcggacctcgcacactggatctggatattttgctctttggcgatcgtatt
atcggtacaccccgtttaactgtaccgcattacgatatgcataatcgtgaattcatgctg
tatcccctttttgagagtgagccggagctgctattacccggcggtgttgcgttaaccgaa
cgattgcgtcaggtgccgcgtaacggccttcgatattgggagaagtag

DBGET integrated database retrieval system