KEGG   Secondary endosymbiont of Ctenarytaina eucalypti: A359_03390Help
Entry
A359_03390        CDS       T02199                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
sect  Secondary endosymbiont of Ctenarytaina eucalypti
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:sect00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(496666..497640)
Genome map
AA seq 324 aa AA seqDB search
MSGIYPILRPRRLRRTPALRTLFQETEVQLSSLVLPIFVEEGVSEYMPLSAMPGVLRIPE
ARLAFEADRYARAGIQSVITFGISHHLDEVGSDTWLENGLVARMVRICKETVPEMIVMSD
TCFCEYTTHGHCGVVRDNWVDNDATLVNLGRQAVVAARAGADIIAPSAAMDGQVQAIRAA
LDSAGFTDTAIMAYSTKFASAFYGPFREAGGTTLKGNRKSYQMNSMNRREAIRESLLDEQ
EGADALMVKPAGAFLDTIRDIREATYLPIAAYQVSGEYAMIKFAAAAGAIDERQIVRETL
GSIKRAGADIILSYFAMDIAEQGF
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtccggtatttatccgattttacgcccacgccgtttacgccgcacaccagctttacgc
actttattccaggaaaccgaggtgcagttgagctctctagtgctgccgatattcgtcgag
gagggggtaagcgaatatatgcccttgtccgccatgccgggcgtgctcagaataccagaa
gcacggctagcctttgaagccgatcgctatgctagagctggcattcaatcagtcatcacc
tttggtatctctcatcatctagacgaggtgggcagcgacacgtggcttgagaatggttta
gtcgcacgaatggtgcgtatttgtaaagagacggtaccggagatgatcgtaatgtctgac
acttgcttttgcgaatacactacccacggtcattgcggcgttgtgcgcgataactgggtt
gataacgatgcaaccttggtgaatttaggacgtcaggccgtggtagccgcgcgcgccggg
gcggatattatcgccccctcagcagcgatggacgggcaggtccaggcgatacgtgccgcc
cttgacagcgctggctttaccgacacagcaatcatggcgtattctaccaaatttgcctca
gcattttacggtccgtttcgtgaggccggcggcaccaccctaaagggaaaccgtaaaagc
tatcaaatgaattcgatgaatcgccgagaagcaattcgtgagtcgttgctagatgagcag
gaaggggccgatgccctcatggtaaaaccggcgggggcttttttagatactatccgcgat
atacgtgaagcaacctatttgccgatagcagcgtatcaagtaagtggcgaatatgcgatg
ataaaatttgcagctgctgctggcgccattgatgaacgtcaaatcgtgcgcgaaactcta
ggttctatcaagagggcaggggcagatataattctcagttatttcgctatggatattgct
gagcaggggttttga

DBGET integrated database retrieval system