KEGG   Secondary endosymbiont of Ctenarytaina eucalypti: A359_03390Help
Entry
A359_03390        CDS       T02199                                 

Definition
(GenBank) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
sect  Secondary endosymbiont of Ctenarytaina eucalypti
Pathway
sect00860  Porphyrin and chlorophyll metabolism
sect01100  Metabolic pathways
sect01110  Biosynthesis of secondary metabolites
sect01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sect00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    A359_03390
Enzymes [BR:sect01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     A359_03390
Exosome [BR:sect04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A359_03390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: AFP84734
UniProt: J3Z3C3
Position
complement(496666..497640)
Genome map
AA seq 324 aa AA seqDB search
MSGIYPILRPRRLRRTPALRTLFQETEVQLSSLVLPIFVEEGVSEYMPLSAMPGVLRIPE
ARLAFEADRYARAGIQSVITFGISHHLDEVGSDTWLENGLVARMVRICKETVPEMIVMSD
TCFCEYTTHGHCGVVRDNWVDNDATLVNLGRQAVVAARAGADIIAPSAAMDGQVQAIRAA
LDSAGFTDTAIMAYSTKFASAFYGPFREAGGTTLKGNRKSYQMNSMNRREAIRESLLDEQ
EGADALMVKPAGAFLDTIRDIREATYLPIAAYQVSGEYAMIKFAAAAGAIDERQIVRETL
GSIKRAGADIILSYFAMDIAEQGF
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtccggtatttatccgattttacgcccacgccgtttacgccgcacaccagctttacgc
actttattccaggaaaccgaggtgcagttgagctctctagtgctgccgatattcgtcgag
gagggggtaagcgaatatatgcccttgtccgccatgccgggcgtgctcagaataccagaa
gcacggctagcctttgaagccgatcgctatgctagagctggcattcaatcagtcatcacc
tttggtatctctcatcatctagacgaggtgggcagcgacacgtggcttgagaatggttta
gtcgcacgaatggtgcgtatttgtaaagagacggtaccggagatgatcgtaatgtctgac
acttgcttttgcgaatacactacccacggtcattgcggcgttgtgcgcgataactgggtt
gataacgatgcaaccttggtgaatttaggacgtcaggccgtggtagccgcgcgcgccggg
gcggatattatcgccccctcagcagcgatggacgggcaggtccaggcgatacgtgccgcc
cttgacagcgctggctttaccgacacagcaatcatggcgtattctaccaaatttgcctca
gcattttacggtccgtttcgtgaggccggcggcaccaccctaaagggaaaccgtaaaagc
tatcaaatgaattcgatgaatcgccgagaagcaattcgtgagtcgttgctagatgagcag
gaaggggccgatgccctcatggtaaaaccggcgggggcttttttagatactatccgcgat
atacgtgaagcaacctatttgccgatagcagcgtatcaagtaagtggcgaatatgcgatg
ataaaatttgcagctgctgctggcgccattgatgaacgtcaaatcgtgcgcgaaactcta
ggttctatcaagagggcaggggcagatataattctcagttatttcgctatggatattgct
gagcaggggttttga

DBGET integrated database retrieval system