KEGG   Secondary endosymbiont of Ctenarytaina eucalypti: A359_03600Help
Entry
A359_03600        CDS       T02199                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
sect  Secondary endosymbiont of Ctenarytaina eucalypti
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:sect00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    A359_03600
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A359_03600
Enzymes [BR:sect01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     A359_03600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(526986..528473)
Genome map
AA seq 495 aa AA seqDB search
MTYCNLRDLISPWVPAAPERVLRNMTLDSRTAATGDLFLAVVGYHTDGRRYIRQAIVKGV
AAVLAQAECTAEEGAIREIHGVPIIYLYRLREQLSELAGRFYQQPSRAMQVIGVTGTNGK
TTTTHLLAQWVQLLGDMSAVMGTVGNGVMGHIHPSASTTGSPIEVQKVLSQCRIQGASLA
AIEVSSHGLVQHRVSDLHFAAAVFTNLSREHLEYHGDMARYEGAKWRLFSELDVHHRIIN
ADDATGRRWLKKLPKAIAVAVCGSLPDKWRGDWLRAGAVRYHARGADIPFFSSWGKGIIH
SQLIGACNVTNLLLALTTLLVLGYSIQKLLKSACRLQSIIGRMEAFHAKGRPMVLVDYAH
TPAALEQALTAARLHVKGNIWCVFGCGGERDKGKRSLMGAIAEQYADRVIITDDNQRGEA
SQDIINDIKSGFLDSSRAHTITARAEAVSSAILQASPTDLVLVAGKGHENCQIIGQHHQA
YSDRTTVAQLLGMME
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtgacctattgtaatttgcgtgatctgatctccccctgggtgcccgcagcgccggagcgc
gttcttaggaacatgaccctagacagccgaaccgcggctactggcgatctgtttttggca
gtcgttggctatcacacagacgggcggcgctatatacgccaagcgatcgtgaaaggcgta
gccgcagtcctcgcacaagctgagtgcacagcggaagaaggcgcaatccgtgagatccat
ggtgtgcctattatctatctttaccgcctgcgagaacagctgtccgagctggcgggtcgt
ttttatcagcagccatcacgcgcaatgcaagtcattggtgttaccggtaccaatgggaaa
actactactacgcatcttttagcacaatgggttcagttattaggtgatatgagtgcggtg
atgggcactgtaggtaacggcgtgatgggccacatccatccgtcagcaagtactaccggc
tcaccgatcgaagtccagaaggtgctgtcgcagtgtcggattcagggcgcaagcttagcg
gcaatagaagtctcgtcccacggtttggtgcagcaccgggtcagtgatctacatttcgcc
gccgcggtatttactaatctgagccgcgagcatttagagtatcatggtgatatggcgcgg
tatgagggggcgaaatggaggctttttagcgaactagatgtccatcatcgcattatcaac
gccgatgacgctaccggtcgtcgctggttaaagaaattgccgaaggcgattgcagtagcg
gtctgtggttcgcttccagacaaatggcggggagactggctgcgcgcaggggcggttcgc
tatcatgctcggggggcggatataccttttttttcaagttgggggaaagggataattcat
agtcaattaatcggagcatgcaacgttaccaacctattgctggcactgaccacactgctc
gtgcttggttattcaatacaaaagctactgaagagcgcctgccgtctgcaatcaattatt
ggtcgaatggaagcttttcacgctaaaggtcgtcccatggtgctggtagattacgctcat
accccggctgccctggaacaggcactgacggctgccaggctgcatgttaaaggtaatatc
tggtgtgtgttcggctgcggaggtgaacgtgataaaggcaagaggtcgctaatgggcgct
attgctgagcagtatgcggaccgtgtgattattaccgatgataatcaacgtggggaagct
tctcaggatattattaacgacattaagagcggctttttggattcaagccgagcgcatacg
attacggcccgagccgaggcggtgtccagcgccattttgcaggcctcgcctacggattta
gttctggtagccggtaagggccatgagaattgccaaattattggccagcatcatcaggcc
tattctgaccgaacgacagtagcgcagctgcttggaatgatggaatga

DBGET integrated database retrieval system