KEGG   Secondary endosymbiont of Ctenarytaina eucalypti: A359_03650Help
Entry
A359_03650        CDS       T02199                                 

Definition
DNA helicase/exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sect  Secondary endosymbiont of Ctenarytaina eucalypti
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sect00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    A359_03650
Enzymes [BR:sect01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     A359_03650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
535454..537373
Genome map
AA seq 639 aa AA seqDB search
MATAYSPHTKGFLMEDILSEAKSLFLFRPLDVHFSRMLATHAEPALMLASACLSAYAGAG
HVCLPLTLLMPGKLFENRMPTLAQQAWLCAGGLSLHEWQRHLLASNAVSDGSCPTPLVLD
RQRLYLHRTWEDECTVAKFFNQMRTELVINDETTIASLLARYFPGKKAVIDWQKIAAAVA
ITRPVSVISGGPGTGKTFIVAKLLTALLQLSSGGRQRMMMAAPTGKAAARLSTSLGLALQ
RLRLTEEQRQCLPREAITLHRLLGARRNSQRLQYHRGNPLHLDALIIDEASMVDLPMMAN
LISALLPKTRVIFLGDRYQLSSVEAGAVLGDLCHFSDAGYSLSRCAELERLTGAPLPACS
NSGGYGVADSLCLLRKSYRFNERSGIGQLANAVNTGNASAALALLHAGTVKDVVYSQLRG
EAEYQRMIDDCVDGYREYWKRVWNHDSPAEILDAFNHFRLLCALREGPFGVSGLNERIEH
ALVRSGLLVLGSTGRYYAGRPVMILHNAPTLGLYNGDIGILLWDQKKILRGYFSLPDGDV
KTAHLRQLPEHETAFAMTVHKSQGSEFHCTALALPSQSFPVLTRELLYTAVTRARERLSL
YATDEVLQYAIATKTQRCSGLIERLADGETAFPSSSKIC
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atggctacggcatacagtcctcacacaaaaggttttttaatggaagatattctttccgag
gccaaaagtttatttctttttcggccacttgacgttcacttttcccgcatgctggccaca
cacgctgagcccgcgctgatgttggctagcgcctgccttagcgcttatgccggcgccggc
catgtatgtctcccattgactttattgatgccggggaagttatttgaaaatcgtatgcca
acgctagcgcagcaagcgtggctgtgcgctggcgggctttctctgcatgaatggcaacga
cacttgctggcatccaatgctgtcagcgacggctcatgtccaacacctctggttctagac
aggcaacgcttgtatttacaccgcacgtgggaagatgagtgcacagtagcaaagttcttc
aatcagatgaggacggagctagtgatcaatgacgaaactactattgcctcactactagcg
cgctattttcccggtaagaaagcagtaatcgattggcaaaaaatcgctgcggcggttgcg
ataacgcgcccagtatcagtgatatcaggaggaccgggcaccggaaaaacatttatagtg
gcaaagctgctaacagcattgctgcagttgagttccggcggccgtcagcgcatgatgatg
gcggctcctaccggtaaggccgctgcgcggctcagcacatctcttggcctggccctacag
cgtctcaggctcactgaagagcagagacagtgtctgccgcgcgaagcgataacgctgcac
cgtttgctgggggctcggcgcaacagccagcggctacagtatcatcgtggaaacccgctt
catctagatgctctcattattgatgaggcatcaatggttgatttacctatgatggctaat
ctgatttcagcactgctgccgaaaacccgggttatattcctaggagatcgttaccagcta
tcgtcggtagaggcgggggctgtgttaggtgatctctgccatttctccgatgccggttac
agcctttcgcgttgcgcggaactcgaacgattaacaggagcgcctctacccgcatgctcg
aacagcggcggttatggagttgccgatagtttatgtttgctacgtaaaagctatcgcttc
aatgaaagatccggtattggccagctagcaaatgccgtcaatactggcaatgccagcgca
gcactagcgttgctgcacgccggaacggtgaaggatgtcgtctactcacagctgcggggg
gaggcggaatatcagcgcatgatcgatgattgtgttgacggctatagggagtattggaag
cgggtgtggaaccatgattcgccggccgaaattctagatgcttttaaccacttccgcctg
ctctgtgcgttgcgggaagggccttttggggtgtcgggtctaaacgaacgtattgagcat
gctttggtccgttcaggactgcttgtcctcggtagtactggtcgctactatgcaggtcgg
ccggtgatgatcctgcacaatgcaccgacactcgggctgtataacggcgatatcggcata
ctactctgggatcaaaaaaaaatactacgcgggtatttctctcttccggacggcgacgtc
aaaacagcacacctcaggcagctcccggagcacgagacggcatttgcgatgacggtgcac
aaatcccaagggtcggagttccattgtacagcgctagcgttacccagtcagagctttcca
gtgttaacgcgggaattactatataccgcagtcacgcgtgcccgagaacggttatcactg
tacgcgactgacgaggtattgcagtatgctattgcaacaaaaactcagcggtgtagtggc
ctgattgaacggctagcagatggtgagactgctttcccgtcatcatctaaaatctgctga

DBGET integrated database retrieval system