KEGG   Secondary endosymbiont of Ctenarytaina eucalypti: A359_04170Help
Entry
A359_04170        CDS       T02199                                 

Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
sect  Secondary endosymbiont of Ctenarytaina eucalypti
Pathway
sect00860  Porphyrin and chlorophyll metabolism
sect01100  Metabolic pathways
sect01110  Biosynthesis of secondary metabolites
sect01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sect00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    A359_04170
Enzymes [BR:sect01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     A359_04170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: AFP84810
UniProt: J3TXC6
Position
complement(602361..603101)
Genome map
AA seq 246 aa AA seqDB search
MSILVTRPAPAGEQLVRKLHARGKTAWHLPLINFTPGYDLPHLPQRLADLSSGDLLFIVS
QHAINYAHPWLTQKGVSWPDELQYYAVGRSTSLRLYTLIGLRVSYPDKGETSEDLLRLPA
LERINGKRALILRGNGGREVLEQTLRQRGVQTTYCECYRRSPIHYDGEEQGRRIRMLGID
TLVITSGEMLQQFYTLMPTYYCRAWLTQCRLIVVSKRLAILAHQLGWTDIVVANAADNDA
LMRVLL
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagcattttagtcacccgaccagcacctgcaggtgaacagctggtgcggaagcttcac
gctcgaggaaaaaccgcgtggcacctgccgcttatcaactttaccccagggtatgattta
ccgcatcttccgcaacggctcgctgatttatcttccggcgatttactctttatcgtctca
cagcatgcaatcaactacgcccacccctggctaacacagaagggcgtcagttggcccgac
gaattgcagtattatgccgtagggcgcagtactagcttacggctgtatacactcattgga
ttgcgggttagctaccccgataagggagaaaccagcgaggatttgcttcgactgcccgcg
ctagagcgcatcaatggtaagcgcgcgctaatcctacgtggtaatggtggtcgggaggta
ctcgaacagactttgcgtcagcgcggcgtgcagactacctattgcgaatgctatcgtcga
agtccaatacattatgatggcgaagagcaggggcggcgtattcgaatgctgggcatagat
acactggtgataaccagtggtgaaatgttacaacaattttatactttaatgccgacatat
tattgtcgagcctggctgacgcaatgccgtctgatagtagtgagcaaacgtttagccata
cttgctcatcaattgggatggacagacatagtagtggcgaatgcagcagacaacgatgca
ttgatgcgtgtattgctctaa

DBGET integrated database retrieval system