KEGG   Secondary endosymbiont of Ctenarytaina eucalypti: A359_04490Help
Entry
A359_04490        CDS       T02199                                 

Definition
DNA polymerase III subunit psi (EC:2.7.7.7)
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
sect  Secondary endosymbiont of Ctenarytaina eucalypti
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:sect00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    A359_04490
   00240 Pyrimidine metabolism
    A359_04490
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    A359_04490
   03430 Mismatch repair
    A359_04490
   03440 Homologous recombination
    A359_04490
Enzymes [BR:sect01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     A359_04490
DNA replication proteins [BR:sect03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     A359_04490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(651761..652168)
Genome map
AA seq 135 aa AA seqDB search
MIRRDWLLQQLGITQWTLRRPELLQRGVALTLPGHVRLLIIAETPPPLDHPLVIDVARSM
ALIPEQLYWLTPLQARYLSDSVRYYFWWLGLEAELDFDGISFHTPPLSVLSADAVAKREL
WSRISNYEYHRTAIT
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgatcaggcgagattggcttttacagcaactaggaattacgcaatggacgctccggcgt
ccagagttactgcaaaggggtgttgctctgaccttacccggtcatgtccgtttattgata
atagctgaaacaccaccgcctcttgatcatcccctggtgatcgatgtggcacgcagcatg
gctctgattccagaacagctctattggctcacgcccctgcaggcgaggtatttgtcggac
agtgtccgttattatttctggtggctaggtcttgaggccgagcttgatttcgatggaatc
tctttccatacaccacccctatcggtgctttcagcagatgctgtcgcaaagcgcgagcta
tggagtcggatcagcaattatgaataccatcgtaccgctattacctga

DBGET integrated database retrieval system