KEGG   Secondary endosymbiont of Ctenarytaina eucalypti: A359_04490Help
Entry
A359_04490        CDS       T02199                                 

Definition
DNA polymerase III subunit psi (EC:2.7.7.7)
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
sect  Secondary endosymbiont of Ctenarytaina eucalypti
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:sect00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:sect00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:sect03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:sect03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:sect03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(651761..652168)
Genome map
AA seq 135 aa AA seqDB search
MIRRDWLLQQLGITQWTLRRPELLQRGVALTLPGHVRLLIIAETPPPLDHPLVIDVARSM
ALIPEQLYWLTPLQARYLSDSVRYYFWWLGLEAELDFDGISFHTPPLSVLSADAVAKREL
WSRISNYEYHRTAIT
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgatcaggcgagattggcttttacagcaactaggaattacgcaatggacgctccggcgt
ccagagttactgcaaaggggtgttgctctgaccttacccggtcatgtccgtttattgata
atagctgaaacaccaccgcctcttgatcatcccctggtgatcgatgtggcacgcagcatg
gctctgattccagaacagctctattggctcacgcccctgcaggcgaggtatttgtcggac
agtgtccgttattatttctggtggctaggtcttgaggccgagcttgatttcgatggaatc
tctttccatacaccacccctatcggtgctttcagcagatgctgtcgcaaagcgcgagcta
tggagtcggatcagcaattatgaataccatcgtaccgctattacctga

DBGET integrated database retrieval system