KEGG   Secondary endosymbiont of Ctenarytaina eucalypti: A359_04910Help
Entry
A359_04910        CDS       T02199                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
sect  Secondary endosymbiont of Ctenarytaina eucalypti
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sect00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
708690..709589
Genome map
AA seq 299 aa AA seqDB search
MTPLRIGRKACKSQGLVVKQLIARERTLCLSVPRVMGILNVTPDSFSDGGRYQSLGAAID
YAAAMLNAGAAIIDIGGESSRPGAETVGEQEEAARVVPVVEAIAERLDTFISVNTSKALV
IRESTIAGAHLINDVRSLSEPGALVEAAASQLPVCLMHMQGNPRTMQQAPYYKDVLGEVE
TYFLEQIHRCEAAGIIKNRLLLDPGFGFGKTLEHNYQLLARLGHFQHLGQPLLVGMSRKS
MIGQLSDLPPDHRVAGSVACAVIAALQGAKIIRVHDVKQTVEAICIVEATLAAKERFFQ
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgacccctttacgtatcggcaggaaagcttgtaaatcacaaggactcgtcgttaagcaa
ctaatagctcgagaacgcactctttgcctttcagtaccacgcgttatggggatccttaac
gtaacgccagactcattctccgacggtgggcgctaccaatctttaggggctgctatcgac
tacgccgcggcgatgctaaatgccggcgcagctattatcgatataggtggtgaatcctcc
cgcccaggggcggagacagtgggcgaacaagaagaggccgcccgcgtagtgccagtagtg
gaagcgatagcggagcgcctcgacacctttatttcagtaaatacttctaaggccttggtt
atacgcgaaagcacaatagctggtgcacatttgattaatgatgtccgttcgcttagcgaa
cctggcgctttagtcgaagctgccgccagccagttacccgtctgtctgatgcacatgcag
ggcaatccacgcaccatgcagcaagcgccttactataaggatgtcctaggggaggtagag
acgtactttctcgaacaaatacatcgctgtgaggcagccggcattatcaaaaatcgtctg
ttactcgaccccggattcggcttcggaaaaacgttagaacataattatcaattactagct
aggctagggcatttccagcatcttggccaacccctgctagtcgggatgtcgagaaaatca
atgatcggtcagctgtcagatctgccgccagaccatcgggttgcgggaagcgttgcttgt
gcagtaatcgctgcgctgcagggggcgaaaattatccgggtgcatgacgttaagcaaacc
gttgaagcaatctgcatagtggaagctacgcttgcagctaaggaaagattttttcaatga

DBGET integrated database retrieval system