KEGG   Secondary endosymbiont of Ctenarytaina eucalypti: A359_07110Help
Entry
A359_07110        CDS       T02199                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sect  Secondary endosymbiont of Ctenarytaina eucalypti
Pathway
sect00010  Glycolysis / Gluconeogenesis
sect00051  Fructose and mannose metabolism
sect00562  Inositol phosphate metabolism
sect01100  Metabolic pathways
sect01110  Biosynthesis of secondary metabolites
sect01120  Microbial metabolism in diverse environments
sect01130  Biosynthesis of antibiotics
sect01200  Carbon metabolism
sect01230  Biosynthesis of amino acids
Module
sect_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sect_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sect00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A359_07110
   00051 Fructose and mannose metabolism
    A359_07110
   00562 Inositol phosphate metabolism
    A359_07110
Enzymes [BR:sect01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     A359_07110
Exosome [BR:sect04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   A359_07110
  Exosomal proteins of bladder cancer cells
   A359_07110
  Exosomal proteins of melanoma cells
   A359_07110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM CagZ
Motif
Other DBs
NCBI-ProteinID: AFP85085
UniProt: J3TXT7
Position
complement(1065495..1066262)
Genome map
AA seq 255 aa AA seqDB search
MRHPLVIGNWKLNGTKRMVKEMSAALCNALSNFVGCDVAIAPPIVYLDLARHYLKNSRIA
LGSQNVDAHLSGAFTGEVSAEMLKDIGAKYIIIGHSERRTYHKESDDVIAEKFAALKAAG
LIPVLCIGESAAEKKSGKTEAICAYQLDAVLNRFGAKVFENTVVAYEPIWAIGTGKPALP
AQVQSVHKFIRSYIAQHDTFITEKMSILYGGSVNDENATELFTQPDIDGALVGGASLKSE
GFVLIVKAAAREKQR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatccgttagtgatcggtaactggaaacttaatggcaccaaaagaatggtcaag
gagatgagcgcagcgctatgcaatgcgcttagcaattttgtcggatgcgacgttgccatc
gctccaccaatagtgtatctcgacctagccagacattatttaaaaaacagccgcattgct
ctcggatcccagaacgttgacgcgcatctttctggcgccttcaccggcgaagtctccgcc
gagatgctcaaagatattggtgcaaaatatatcatcattggtcattctgagcgtcgtact
tatcataaagaaagcgatgacgtgatcgccgaaaaattcgccgctctaaaagcagcaggt
ttaattccggtcttgtgtatcggtgaaagtgcagcagaaaaaaaatccggaaaaactgaa
gcgatatgtgcttatcagcttgatgcggtacttaaccgcttcggggctaaagtgtttgaa
aatactgttgtggcctatgagcctatctgggctattggaactggaaaaccagctctacct
gcgcaagtgcaatcagtgcataaatttatccgtagctatattgctcaacatgatacattc
atcacagaaaaaatgagtatactttatggaggttcagtgaacgacgaaaatgccactgaa
ctgtttactcaaccggatattgatggtgcgctggtcggcggggcatcactaaaatctgag
ggcttcgtgctaatcgtcaaggcagcagcccgagagaaacaaagatga

DBGET integrated database retrieval system