KEGG   Secondary endosymbiont of Ctenarytaina eucalypti: A359_07110Help
Entry
A359_07110        CDS       T02199                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sect  Secondary endosymbiont of Ctenarytaina eucalypti
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sect00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    A359_07110
   01230 Biosynthesis of amino acids
    A359_07110
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A359_07110
   00051 Fructose and mannose metabolism
    A359_07110
   00562 Inositol phosphate metabolism
    A359_07110
Enzymes [BR:sect01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     A359_07110
Exosome [BR:sect04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   A359_07110
  Exosomal proteins of bladder cancer cells
   A359_07110
  Exosomal proteins of melanoma cells
   A359_07110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1065495..1066262)
Genome map
AA seq 255 aa AA seqDB search
MRHPLVIGNWKLNGTKRMVKEMSAALCNALSNFVGCDVAIAPPIVYLDLARHYLKNSRIA
LGSQNVDAHLSGAFTGEVSAEMLKDIGAKYIIIGHSERRTYHKESDDVIAEKFAALKAAG
LIPVLCIGESAAEKKSGKTEAICAYQLDAVLNRFGAKVFENTVVAYEPIWAIGTGKPALP
AQVQSVHKFIRSYIAQHDTFITEKMSILYGGSVNDENATELFTQPDIDGALVGGASLKSE
GFVLIVKAAAREKQR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatccgttagtgatcggtaactggaaacttaatggcaccaaaagaatggtcaag
gagatgagcgcagcgctatgcaatgcgcttagcaattttgtcggatgcgacgttgccatc
gctccaccaatagtgtatctcgacctagccagacattatttaaaaaacagccgcattgct
ctcggatcccagaacgttgacgcgcatctttctggcgccttcaccggcgaagtctccgcc
gagatgctcaaagatattggtgcaaaatatatcatcattggtcattctgagcgtcgtact
tatcataaagaaagcgatgacgtgatcgccgaaaaattcgccgctctaaaagcagcaggt
ttaattccggtcttgtgtatcggtgaaagtgcagcagaaaaaaaatccggaaaaactgaa
gcgatatgtgcttatcagcttgatgcggtacttaaccgcttcggggctaaagtgtttgaa
aatactgttgtggcctatgagcctatctgggctattggaactggaaaaccagctctacct
gcgcaagtgcaatcagtgcataaatttatccgtagctatattgctcaacatgatacattc
atcacagaaaaaatgagtatactttatggaggttcagtgaacgacgaaaatgccactgaa
ctgtttactcaaccggatattgatggtgcgctggtcggcggggcatcactaaaatctgag
ggcttcgtgctaatcgtcaaggcagcagcccgagagaaacaaagatga

DBGET integrated database retrieval system