KEGG   Secondary endosymbiont of Ctenarytaina eucalypti: A359_07570Help
Entry
A359_07570        CDS       T02199                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
sect  Secondary endosymbiont of Ctenarytaina eucalypti
Pathway
sect00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sect01100  Metabolic pathways
sect01110  Biosynthesis of secondary metabolites
sect01130  Biosynthesis of antibiotics
sect01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sect00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    A359_07570
Enzymes [BR:sect01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     A359_07570
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     A359_07570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI
Motif
Other DBs
NCBI-ProteinID: AFP85127
UniProt: J3TFR1
Position
1127418..1128776
Genome map
AA seq 452 aa AA seqDB search
MQDTVLAKIVADKYEWVSKHKRLKPLASFLHQVMPSTRSFYHALSGAKKVFILECKKASP
SNGLIRANFDPVAIAGVYRPYASAISVLTDEKHFQGSFDFLHQVSRTVSQPVLCKDFIID
PWQIYLARLYQADAILLMLSVLDDDTYRKLAEVSHRLQMGVLTEVISEKERQRAISLKAK
VVGINNRDLRDLSIDLNRTRTLGPKLPAGVTVISESGINNYCQVRELSHYANGFLIGSAL
MREPELTLALDRILLGDNKVCGLTRAADAQAARAVGALYGGLIFVPGSPRYLEADMARAV
IAGATLRYVGVFRDAPVSDVAARANLLSLSAVQLHGDEDQPYIDALRQVLPPKCHIWKAL
DMRHPLPARDLTQVDRYVLDNGGGHGKPFDWSLLNGMILDNVMLAGGLDADNCAAAASLG
CVGLDFNSGVESTPGIKDYQKLATVFQILRAY
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacacagtacttgcgaaaattgtcgcagataaatatgaatgggtatctaagcat
aaacggctaaaaccattggcgagttttcttcatcaggttatgcctagcacgcgtagtttt
tatcacgcactttccggcgctaaaaaagtatttatattggaatgtaaaaaagcgtcacca
tctaacggccttatccgcgctaatttcgatccggttgctatagcgggcgtttaccggcct
tacgcgtccgcgatttcggtattgaccgacgagaagcattttcagggaagtttcgatttt
ttgcaccaggtgagtcgtacggtaagccagccggtgttatgtaaagattttattatcgat
ccatggcaaatttacctagcacgcctataccaggcggatgcgattttgctgatgttgtcc
gttcttgacgacgatacctaccgtaaactagctgaagtgtctcacagacttcagatggga
gtgctcacggaagttattagcgaaaaagagcggcagcgcgctattagcctaaaagcgaaa
gtagtggggattaataatcgagatttacgggacctgtctatcgatttgaaccgcactcgc
acattggggccgaagctgccggctggtgtcacagttatcagcgagtccggcatcaataat
tattgtcaggtacgcgaactcagtcactacgctaatggcttcttgatcgggagtgctctc
atgagagagcctgaattaacgctagccttagaccggattctgctaggtgataacaaagtt
tgcggtttgacgcgtgctgccgatgcccaagctgccagggcggttggcgcgctctatggc
gggctgatcttcgtccccggctccccgcgctacctggaggcagacatggctcgtgcggtc
attgccggcgctacactccgctatgtcggagtttttcgcgatgctccggtgagcgatgtt
gctgcaagggcaaatttgttgtcgctgtcggcagttcagttgcacggcgatgaagatcag
ccttacattgacgccctacgtcaggtcttgccacctaagtgccatatttggaaagcgctg
gatatgcgccatccccttccggcccgtgatttgacacaggtagatcgctatgttcttgac
aacggtggaggtcatggaaaaccgtttgattggtcattgttaaatggaatgatattagat
aacgtgatgctggcgggtggtcttgacgcagataattgcgctgctgcggctagtcttggt
tgcgtagggctggattttaattctggcgtagaaagcaccccaggtatcaaagattatcag
aaattggctacggtatttcagattctacgtgcctattaa

DBGET integrated database retrieval system