KEGG   Secondary endosymbiont of Ctenarytaina eucalypti: A359_07580Help
Entry
A359_07580        CDS       T02199                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sect  Secondary endosymbiont of Ctenarytaina eucalypti
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sect00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    A359_07580
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A359_07580
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    A359_07580
Enzymes [BR:sect01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     A359_07580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1128810..1130000
Genome map
AA seq 396 aa AA seqDB search
MTRINPYFGEFGGMYVPQILMPALMQLEDAFVDAQSDPAFQREFGDLLTQYAGRPTPLTL
CRNLTTGTQTKIYLKREDLLHGGAHKTNQVLGQALLTKRMGKAEVIAETGAGQHGVAAAL
SSALLELKCRIYMGAKDIERQSPNVFRMRLMGAEVIPVYSGSSTLKDACNEALRDWSDSY
ERAHYMLGTAAGPHPFPTIVREFQRMIGEETRMQIQEQEKCLPDVVIACIGGGSNAIGMF
ADFIDKPGVRLIGVEPGGLGIATGRHGASLQYGRTGIYFGMKSPIMQSSEGQIEESYSIS
AGLDFPSVGPQHAYLDSIGRAEYVSVTDEEALHAFRHLARQEGIIPALESSHAIAHALRM
MKADPEKEQILVVNLSGRGDKDIFTVHKILSARGEI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacacgaattaatccttattttggtgaatttggcggcatgtacgtaccgcaaatcctg
atgcctgctctgatgcaactggaagatgcatttgtcgatgctcaaagtgacccggcgttt
cagagagaatttggcgatctactcactcagtatgccggccggccgacgccgctaacactg
tgccgaaatctgacgacaggtactcagactaagatatatctgaaacgagaagatttattg
cacggcggcgcccataaaactaatcaggtactgggacaagcgttattgactaaacgaatg
ggtaaagctgaagtcattgccgaaacgggcgcgggccaacatggcgtggcagctgcttta
tcctccgctcttctggagttgaaatgccgtatttatatgggggctaaagatattgaacgc
caatcacctaacgtttttcgtatgcggctaatgggtgctgaggtcattccagtatacagc
ggctcctccaccctgaaagacgcgtgtaatgaggcattgcgcgactggtccgatagctat
gaacgcgcacactatatgcttggcactgctgctggcccgcatccttttccaactatcgtg
cgcgaatttcaacggatgatcggcgaggagacgcgcatgcagatacaagagcaagagaag
tgcctgccagatgtggtaattgcttgcattggcggtggctctaacgctatcggtatgttc
gcggattttattgataaaccaggtgttcgcctgataggtgtagagccaggcggactaggc
attgcaacaggtcggcatggcgcatcgctgcagtatggacgtactggtatctattttggc
atgaaatctccgatcatgcagtcttctgaagggcaaattgaagagtcctactccatttct
gccggcctagacttcccttcggtaggtccccagcatgcttatcttgatagcatcggtcgt
gccgagtatgtgtcggtcaccgacgaagaagccctacatgctttccgacacctcgctcgc
caggagggaattatccctgccctggaatcctcacatgccattgcccatgcgctacggatg
atgaaagcagacccggagaaggagcagatcctggtggtgaatctttctggccgaggcgat
aaagatattttcaccgtacataagattttatcggcaagaggagaaatctaa

DBGET integrated database retrieval system