KEGG   Secondary endosymbiont of Ctenarytaina eucalypti: A359_07590Help
Entry
A359_07590        CDS       T02199                                 

Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sect  Secondary endosymbiont of Ctenarytaina eucalypti
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sect00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    A359_07590
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A359_07590
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    A359_07590
Enzymes [BR:sect01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     A359_07590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1130002..1130808
Genome map
AA seq 268 aa AA seqDB search
MERYQKLFSRLAARNEGAFVAFVTLGDPNPAYSLKIIDTLIDAGADALELGVPFSDPLAD
GAIIQNANLRAFASGVTRAHCFEMLASIRLKYPEIPIGLLIYANLVYSNGINAFYARCSG
VGVDSVLVADVPLQESLPFRHAALQHGVAPIFICPPNADDALVRKISLYSKGYTYLLARS
GVTGSEKRAKTPVVHLINALKEHQAAPTLQGFGISEPNQVRNACRAGVAGAISGSAIVRL
IENHVDNLEVMLEKLAHFVREMKIATLP
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaacgctatcagaaattatttagccgattagcggcccgtaatgaaggtgcgttcgta
gcatttgtaacacttggagatcctaaccccgcgtactcgctaaaaatcattgatacactc
atcgatgctggtgctgatgcactagagctgggtgttcctttctcagatccactggcggat
ggagctatcattcaaaatgctaacctgcgtgcgtttgcctctggagttacccgggcgcac
tgttttgagatgctggcatcaattcgcttgaaataccccgagatccccattggcttactg
atctatgctaatttagtatacagcaatggtattaatgctttttacgctcgctgctctggc
gtcggtgtcgactctgtgttggtagcggatgtgccactacaagaaagcctgccgtttcgt
catgcagctttgcaacatggtgtagcgcctatttttatctgtcctcccaacgctgacgat
gctttagtgcgcaagatctctttgtatagcaaaggctatacctatctgctagcgcgttcc
ggtgttacaggaagcgaaaaacgagcgaagacaccagtagtgcacttaatcaatgctttg
aaggagcaccaagcagccccgacgctacagggatttggcatttctgagcccaaccaggtg
cgcaatgcttgccgcgccggggttgctggcgctatctccggctccgctatcgtacgtctt
atcgaaaaccatgtagataatttggaggtaatgctagaaaaattagcgcatttcgtacgg
gagatgaagattgctactctaccttga

DBGET integrated database retrieval system