KEGG   Secondary endosymbiont of Ctenarytaina eucalypti: A359_08450Help
Entry
A359_08450        CDS       T02199                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
sect  Secondary endosymbiont of Ctenarytaina eucalypti
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sect00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    A359_08450
Enzymes [BR:sect01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     A359_08450
Transfer RNA biogenesis [BR:sect03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    A359_08450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1254944..1255690
Genome map
AA seq 248 aa AA seqDB search
MIEKIITLSRDAGAAIMQVYNSQRSLESSQKEDNSPVTAADLAAHKVIAAGLQMLSPDIP
LLSEEDPPDWSVRQHWRHFWLVDPLDGTKEFLRRTGEFTVNIALIEDGKPLMGVVYAPIT
NRLYAAVDGNAWSIKEHRKPKPIKVKAAHPPLVVLSRSHGNNAELRNYLVQLGEHQTLMI
GSSLKFCLVAEGAAQLYPRFGPTNIWDTAAGHAVASAAGAQVNDWEGRTLDYTPRESFLN
PAFRVSLF
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgattgaaaaaattatcactctttcccgtgacgctggggcagctatcatgcaggtctac
aacagtcaacgatcgctagagtcgagtcagaaggaagataactcgcctgtgactgccgcg
gatctggctgcacataaggtcatcgcggctggtttacagatgctgtcgcctgacatccct
cttctttccgaagaggatccccctgactggtctgttcgtcagcattggcgccatttttgg
ttggtagatcctttagatggcactaaggaatttctgcgccgaaccggtgaatttacggtt
aatatcgcattaatcgaagatggcaagcctctgatgggcgtcgtctatgcaccgatcact
aataggctatatgcggcagtagacgggaatgcatggagcatcaaagagcatcgtaagccc
aagcctattaaagtaaaagcggcgcatccaccactggtggttttgagtcgttcgcacggc
aacaatgcggagttgcggaattatctagttcaactaggcgaacatcagactctgatgatc
ggctcatcgttaaaattttgtctagtggcggagggtgccgcacagctgtatcctcgattt
ggaccgaccaacatctgggacacagccgcaggacacgcagtggcttctgcggctggtgct
caagtcaatgattgggagggacggacactggattatacgccacgtgaatcattcctgaat
cctgcttttagggtatcgctgttctaa

DBGET integrated database retrieval system