KEGG   Secondary endosymbiont of Ctenarytaina eucalypti: A359_09060Help
Entry
A359_09060        CDS       T02199                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sect  Secondary endosymbiont of Ctenarytaina eucalypti
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sect00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    A359_09060
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A359_09060
   00052 Galactose metabolism
    A359_09060
   00500 Starch and sucrose metabolism
    A359_09060
   00520 Amino sugar and nucleotide sugar metabolism
    A359_09060
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    A359_09060
   00524 Butirosin and neomycin biosynthesis
    A359_09060
Enzymes [BR:sect01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     A359_09060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1344366..1345331)
Genome map
AA seq 321 aa AA seqDB search
MINYVLVGDVGGTNVRLALCYLSTGEISHIHTYASDGYDNLESVIHNYLISQQVAIKEAC
IAIACPINSDWVEMTNHSWAFSIKAMQANLELEQLEIINDFTAVAMATPMLTEKEVIQFG
GRHSIIGKPIAIYGAGTGLGVSHLLQVEKRWISLPGEGGHVDFAPNSEEEYSILNVLREE
LGHVSAERVLSGPGLVNLYRAIVKVDERLPENLLPKQVTKQALADSCIDSRRALSLFCVL
MGRFGGNLALNMGTFGGVYIAGGIVPRFLDFFRASGFRAAFEDKGRFKDYLLDIPVYLIR
HDQPGLLGAGAHIRQLMGYQL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgataaactatgtactagtcggtgatgttggaggtaccaacgtccggctagcgctgtgt
tatttaagtactggagagatttcccacatccatacctacgccagcgatggttacgacaac
ctggaaagcgtcattcataattatctaattagccaacaagttgctattaaagaagcctgc
attgctattgcctgtccgattaacagcgattgggttgaaatgaccaaccattcctgggcg
ttctccattaaagcgatgcaagctaacttagaattagagcaattagaaattattaatgac
ttcaccgcagtagcaatggccactcctatgctaacagaaaaagaagttattcagttcggt
ggccgtcactctattatcggaaagccaattgcaatttacggcgctggcacggggctaggt
gtaagccatcttctccaagtagagaagcgctggattagcctacctggagagggaggccat
gtagattttgcacctaacagtgaagaagagtacagcattctaaatgtgcttcgggaggaa
ttgggacatgtttctgcggagcgagtactgtcaggcccaggtttggtaaatttgtaccgc
gctattgtcaaggtcgacgaacgcttgcctgaaaatctattgccaaagcaggttactaaa
caagctctagccgacagctgcatcgacagccgacgtgctctgtcgctgttctgcgttcta
atgggccgcttcggcggcaacctcgcattaaatatgggaaccttcggtggtgtatatatt
gccggcggcattgtgccgcgatttttagatttcttccgcgcctccggtttccgcgcagct
tttgaagataaagggcgctttaaagattatcttctagatattcctgtgtacttaatccgt
catgatcagccaggattgctcggtgccggtgcccatatccggcagctaatgggctatcag
ctgtaa

DBGET integrated database retrieval system