KEGG   Secondary endosymbiont of Ctenarytaina eucalypti: A359_09560Help
Entry
A359_09560        CDS       T02199                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sect  Secondary endosymbiont of Ctenarytaina eucalypti
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sect00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    A359_09560
   01230 Biosynthesis of amino acids
    A359_09560
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A359_09560
   00030 Pentose phosphate pathway
    A359_09560
   00051 Fructose and mannose metabolism
    A359_09560
   00052 Galactose metabolism
    A359_09560
  Energy metabolism
   00680 Methane metabolism
    A359_09560
Enzymes [BR:sect01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     A359_09560
Protein phosphatases and associated proteins [BR:sect01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     A359_09560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1419397..1420359
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDSPGMNAAIRGVVRSGLSEGLEVYGIYDGYLGLFQNRMAKLDRYSVSD
MINRGGTFLGSARFPAFREAGTRAIAIENMAQRGLDALVVIGGDGSYMGAKHLTEMGPPC
IALPGTIDNDVAGTDYTIGYFTALETVVEAIDRLRDTSTSHQRISIVEVMGRYCGDLTMA
AAIAGGCEFIVLPEVKFKPEDLVDEIKAGIAKGKKHAIVAITEHICNVAELVQYIEKETG
QETRATVLGHIQRGGTPVAYDRILASRMGAYSIELLLQGYGGHCVGVQNERLLHHEIVDA
IKNMKRPFRSDILETAKKLF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaaatcggtgtgctgacaagtggtggtgattcaccgggcatgaatgcggcc
attaggggtgtggttcggtctggcctttctgaaggcttagaagtttacggcatttatgat
ggctatctaggcttatttcagaatcgaatggcgaaactagaccgttatagcgtttcagat
atgattaaccgtggaggcacctttctcggttcggcacgtttccctgccttccgagaggca
ggcactcgcgcgatcgcgattgaaaacatggctcagcgaggtctggatgcgctagtagtg
ataggcggagacggctcctatatgggtgctaagcacttgacagaaatgggtcccccctgt
attgccctacctggcactattgataatgacgtggcaggtactgattacaccattggctac
tttaccgcgctggaaaccgtcgtcgaagctattgaccgtcttcgtgatacgtctacttca
catcagcgtatttccattgtggaggtcatgggacggtattgtggtgatttaactatggca
gctgctatcgccggcggttgtgaatttattgttttgcctgaagtaaaattcaaaccagaa
gacctagttgacgaaatcaaggcgggtattgctaaaggcaaaaaacatgccattgtcgcg
attactgaacatatctgtaatgtcgctgagctggtgcaatacatagaaaaagaaacggga
caggaaacgcgggccacggtactgggccatattcagcgcggcggaacgccggtagcctat
gaccgtattttggcctcacgcatgggcgcgtactccatcgagttattgttgcagggttat
ggcggccattgtgtcggcgtgcagaatgaacggcttctgcatcacgaaatcgtcgacgcc
attaaaaatatgaaacgccccttccgcagcgatattttagaaacggcaaaaaaactattc
taa

DBGET integrated database retrieval system