KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0091Help
Entry
SeD_A0091         CDS       T00757                                 

Gene name
folA
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sed00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SeD_A0091 (folA)
   00670 One carbon pool by folate
    SeD_A0091 (folA)
Enzymes [BR:sed01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     SeD_A0091 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
96338..96817
Genome map
AA seq 159 aa AA seqDB search
MISLIAALAVDRVIGMENAMPWNLPADLAWFKRNTLNKPVVMGRHTWESIGRPLPGRKNI
VISSQPGTDDRVQWVKSVDEAIAACGDAPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVE
GDTHFPDYEPDDWESVFSEFHDADAQNSHSYCFEILERR
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgatcagtctgattgcggcgttagcggtggatcgcgtcatcggtatggaaaacgccatg
ccgtggaacctgcctgccgatctcgcctggtttaaacgtaacacgttaaataaacctgtc
gtcatgggacgtcacacctgggagtccatcggacgccccttaccgggacgtaaaaatatt
gttatcagcagccagccaggcaccgacgatcgcgtgcagtgggtgaagtctgtcgatgag
gcgattgccgcttgcggcgatgcgccggaaattatggtcattggcggcgggcgcgtgtac
gagcagttcctgccaaaggcgcagaagctttatctgacgcatattgatgcggaagtcgaa
ggcgatacccattttccggattatgaaccggatgactgggaatcggtattcagtgagttt
cacgatgccgacgcgcagaattctcacagctattgtttcgagattctggaacgtcgttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system