KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0242Help
Entry
SeD_A0242         CDS       T00757                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:2.7.4.-)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:sed00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SeD_A0242 (dxr)
Enzymes [BR:sed01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     SeD_A0242 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
258598..259881
Genome map
AA seq 427 aa AA seqDB search
MYKAPRRRHYQVSCAAFCFLFRFNTSGRFMKQLTILGSTGSIGCSTLDVVRHNPDSFRVI
ALVAGKNVARMAEQCLEFSPRYAVMDDTSSAEQLKIMLQQHGSRTEVLSGQQAACEMAAL
DEVGHVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDEVKRSNARLLPVDS
EHNAIFQSLPQSIQHNLGYADLEQNGVTSILLTGSGGPFRETPMCDLAAMTPDQACRHPN
WSMGRKISVDSATMMNKGLEYIEARWLFNASARQMEVLIHPQSVIHSMVRYQDGSVLAQL
GEPDMRTPIAHTMAWPNRVTSGAQPLDFCKLSALTFSAPDYQRYPCLKLAMEAFEQGQAA
TTALNAANEITVAAFLAQQIRFTDIAGLNLAVLERMDLHEPASVEDVLQVDAIAREVARK
QVIRLSR
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgtacaaagcgccgcgcagaagacattatcaggtctcctgtgcggcgttttgcttttta
ttccgtttcaacacttctggacgtttcatgaagcaattaaccattctgggctcgaccggc
tctattggttgcagcacactggacgtggtgcgccataatcctgatagcttccgcgttatc
gcgctggtggcgggtaaaaatgtcgcccgcatggcggagcagtgcctggagttctcgccg
cgttatgccgtgatggacgatacgtcgagcgcagaacagctcaaaataatgcttcagcag
catggcagccgcaccgaggttctgagcggtcagcaggctgcctgtgagatggcggcgctt
gatgaggtcgggcatgtgatggcggccattgtgggcgcggctggtttactgccgaccctg
gcggcgattcgcgcagggaagacgattctgctggcgaataaagaatcgctggtgacctgc
gggcggctgtttatggacgaagtaaaacgcagcaacgcccggcttttacccgtcgatagc
gaacataacgcgatttttcagagtttgccgcaatctattcagcataatctgggatacgct
gaccttgagcaaaatggcgtaacgtcgattttgcttaccgggtctggtggcccgtttcgt
gaaacgcccatgtgcgatctggcagcgatgacgccggatcaggcatgtcgtcatccgaac
tggtcgatggggcgaaaaatctccgtcgactccgccaccatgatgaataaaggtctggaa
tacattgaagcgcgttggttatttaatgccagcgcacgtcagatggaagtgttgatccat
ccgcaatcggtcattcattcgatggtgcgttatcaggacggcagcgtcctggcgcagctt
ggagaacctgacatgcgtacgcctattgcgcatacgatggcatggccgaatcgcgtcacg
tccggcgcgcagccgctcgatttttgcaaactcagcgcgctgacgtttagcgcgccagat
tatcagcgttatccttgcctgaagctggcgatggaggcgtttgagcaaggtcaggcggca
acgacggcgctcaatgcggcaaacgaaatcaccgttgccgcgtttctggcgcaacagatt
cgttttaccgatatcgccgggctcaatttagcggtgctggagaggatggatttacacgaa
ccggcaagcgttgaggacgtattgcaggttgacgccatcgcgcgtgaagtagccagaaaa
caagtgatacggctctcacgctga

DBGET integrated database retrieval system