KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0390Help
Entry
SeD_A0390         CDS       T00757                                 

Definition
type III restriction-modification system StyLTI enzyme res (EC:3.1.21.5)
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Brite
Enzymes [BR:sed01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     SeD_A0390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
408695..411664
Genome map
AA seq 989 aa AA seqDB search
MNILLEELPHQEQALAAILASFTGIDHAQADHNHYANPLIKERYDDKANIDVKMETGTGK
TYVYTRLMYELHQKYGLFKFVLVVPTPAIKEGARNFITSDYARQHFSQFYENTRMELCTI
NAGDFKVKSGRKNFPAQLLSFTDASRRDSHTIQVLLINAQMLNSASMTRDDYDQTLLGGL
TSPVKGLQMTRPVVIIDEPHRFARDNKFYRAIQAIQPQMIVRFGATFPDIVEGKGKNKCV
RKDYYRRQPQFDLNAVDSFNDGLVKGIDIYYPNLPEEQANNRYIVDSVTAKKLILRRGSK
IAEVGVGENLADVDAGFEGSIEYAGSKMLSNDLELEAGMALVPGTFGASYQELIIQDAID
KHFDTEQANFLRSNEPENNAPRIKTLSLFFIDSIKSYRDDEGWLKLKFECLLKKKLTQLI
DDYQRKTLPREVEYLSFLQATLASLHSDNQNVHAGYFGEDRGSGDEAIQAEVDDILKNKE
KLLSFSDHHGNWETRRFLFSKWTLREGWDNPNVFVIAKLRSSGSESSKIQEVGRGLRLPV
DENGHRVHQEEWPSRLSFLIGYDEKAFASMLVDEINRDSKVQLNEQKLDEAMITLIVTER
QKVDPAFTELRLLEDLDDKKLINRSNEFKPSVTLNGGTKSGFAWLLEFYPELTQARVRAD
RIRDNKPASRLRVRLRKENWEQLSSIWEQFSRRYMLQFERSGASLEQIAAEVLRDPALYI
RQKPSQVQQRLVSNEDNGRFEVAQREGELAASEFMAGMKYGHFLKQLALRTSLPVNVLHP
VLMAMLRDVLHGDSRYLSEISLDNMTRALQTRINAHFAQRHDYLPLDFQASTSVFDSTAR
QFREEISAEIVGKNVDENAIDDPRSLYQIPPLRYDSVDPELPLLKYDYPQQVSVFGKLPK
RAIQIPKYTGGSTTPDFVYRIERQDADSVYLLVETKAENMRVGDQVILDAQRKFFDMLRR
QNINVEFAEATSAPAVFSTINGLIEGKAN
NT seq 2970 nt NT seq  +upstreamnt  +downstreamnt
atgaatattttactggaagaacttccccatcaggaacaggcgttagcggcgattctggcg
agtttcaccggtatcgatcacgcgcaagccgatcataatcactatgctaatccgctgatt
aaggaacgttacgacgataaggccaatattgacgttaaaatggagaccgggacgggtaaa
acctatgtctatacccggttgatgtatgaattgcatcagaagtatggcctcttcaaattt
gtgctggtggtgccgacgccagccattaaagaaggcgcgcggaactttattaccagcgat
tacgccagacagcatttttcacagttctacgaaaatacgcggatggaactttgcaccatc
aacgccggtgattttaaagtaaagtcggggcgtaaaaattttccggcccagctattaagt
tttactgatgccagccgtcgtgatagccatacgattcaggttttgctgatcaatgcgcaa
atgctcaattccgccagtatgacgcgagacgattacgatcaaacgctcctgggcgggctg
acgtcgcctgttaaagggctgcaaatgacgcgaccggtggtcattattgatgaaccgcat
cgttttgcgcgagataacaaattttatcgagcgattcaggctattcagccgcaaatgatc
gtccgctttggcgctaccttcccggatattgtcgaaggtaagggtaaaaataaatgtgta
cgtaaagattactatcgccggcaaccgcagtttgatctcaacgcggtggacagttttaac
gatggtttggtgaaaggtattgatatttattacccgaatctccccgaagaacaggccaac
aatcgttatatcgttgacagcgtcacggcaaagaaattaatcctccgacgggggagcaaa
attgccgaggttggcgtgggcgaaaatctcgccgatgtcgatgcaggatttgaaggcagt
attgaatatgccggcagtaaaatgttgtcgaacgatctggagctggaggcagggatggcg
ctggtgccaggaacctttggcgcgagctaccaggaactgattattcaggacgccattgat
aagcattttgataccgagcaggcaaatttcttacgcagcaatgagccagaaaataatgcc
ccgcgtattaagaccttaagccttttctttattgacagtattaaaagctatcgtgatgac
gaaggttggttgaaactgaagtttgagtgtttactgaaaaagaaactgacgcaactgatt
gacgattatcagcgcaagaccctgccgcgagaagtggagtatctgtcgtttctgcaggcc
acgctcgccagcctgcactcggataaccaaaacgtccacgctggttactttggcgaagac
cgcggaagcggcgatgaggcgatccaggctgaggtagatgatattctgaaaaataaagag
aagttgctcagtttttcagaccatcacggcaactgggaaacgcgccgctttctgttttca
aaatggacgcttcgcgaaggctgggataacccgaatgtttttgtcattgctaaattacgt
tcttccggtagcgagtcgagcaaaattcaggaagtggggcgcggcctgcggctaccggta
gatgaaaacggccatcgcgttcatcaggaagagtggccgtcccgactgtcgtttctgatt
ggttatgatgaaaaagcgtttgccagtatgctggttgatgagattaatcgcgacagcaaa
gttcagcttaacgagcagaagctggatgaggcgatgatcacactcatcgtcaccgagcga
caaaaagtcgatcctgcgtttacggagcttcgtttgctggaagatctggatgataaaaaa
ctgatcaaccggagtaatgagtttaaacccagcgtcacgcttaacgggggaaccaaaagt
ggctttgcgtggctactggagttctaccctgagctgacgcaggcgcgggtgcgagcggat
cgcattcgtgacaataagcccgcctcccgactgcgagtcaggttacgcaaagagaattgg
gaacaacttagcagtatctgggagcagttttcccgccgttatatgctgcaattcgagcgt
agcggcgcgtctctggaacagattgccgccgaggtgctgcgcgatccggcgctgtatata
cgccagaagccaagccaggttcaacaacggctggtatcgaatgaagataatggccgtttt
gaagtggcgcagcgggaaggcgaattagccgccagcgaatttatggcgggcatgaaatat
ggccattttcttaagcaactggcgttacgcaccagtctgccggttaacgtcctgcacccg
gtgttaatggcgatgctgcgtgatgttttgcacggagattcacgctatttaagcgagatc
tcgttggacaatatgacccgcgcattacagacgcggattaatgcgcattttgcgcagcgc
cacgattatctgcctctcgattttcaggcttcaacgtcggtatttgattccacggcacgg
cagttcagagaggagattagcgctgaaattgtggggaaaaatgtggatgagaatgcgata
gacgatcctcgttctctctatcaaataccgccgttgcgttatgacagcgtcgatccagaa
ttgccgctattaaaatacgattatccgcaacaggtttctgtgtttggcaaactgcctaag
cgggccattcagatccccaaatatacggggggctctactacgccggattttgtgtaccgt
attgagcgtcaggacgccgacagcgtttatttactggttgaaactaaagcagaaaatatg
cgcgtaggcgatcaggttattcttgatgcgcaacgtaaattcttcgatatgctgcgtcgg
caaaatattaatgtcgagtttgcggaagcgaccagcgcgccggcggtattttctaccatc
aatggcttgattgaggggaaggcaaactaa

DBGET integrated database retrieval system