KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0531Help
Entry
SeD_A0531         CDS       T00757                                 

Gene name
recR
Definition
(RefSeq) recombination protein RecR
  KO
K06187  
recombination protein RecR
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sed00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SeD_A0531 (recR)
DNA repair and recombination proteins [BR:sed03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SeD_A0531 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
546526..547131
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADC
RTFTEQDVCNICSNPRRQENGQICVVESPADIYAIEQTGQFSGRYFVLMGHLSPLDGIGP
DDIGLDRLEQRLASEKISELILATNPTVEGEATANYIAELCAEAGVEASRIAHGVPVGGE
LEMVDGTTLSHSLAGRHKIIF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagtccgctgttaactcagcttatggaagcgttgcgctgccttccgggcgtc
ggccctaagtcggcgcagcggatggcgtttaccctgttgcagcgcgatcgcagcggcgga
atgcgcctggcgcaggcgctgacccgggcgatgtcggaaatcggccactgcgccgactgc
cgcacctttaccgagcaggatgtctgtaatatctgttcgaacccgcggcgtcaggaaaac
ggccagatttgcgtggtggagagtcctgcggatatctacgccattgagcagaccgggcaa
ttttccgggcggtatttcgtgctgatgggccacctgtcgccgctggacggcatcgggccg
gatgatatcggtctcgatcgtctggaacagcggctggcgtcagaaaaaatcagcgagctg
atcctcgcgaccaacccgacggttgaaggagaggctaccgcaaactatattgccgagctg
tgcgcggaggccggcgtcgaagccagtcgtatcgcccacggcgtgccggttggcggcgaa
ctggagatggtcgacggtacgacgctgtcccactcgctggcgggacgccataagattatt
ttctga

DBGET integrated database retrieval system