KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0531Help
Entry
SeD_A0531         CDS       T00757                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sed00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SeD_A0531 (recR)
DNA repair and recombination proteins [BR:sed03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SeD_A0531 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
546526..547131
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADC
RTFTEQDVCNICSNPRRQENGQICVVESPADIYAIEQTGQFSGRYFVLMGHLSPLDGIGP
DDIGLDRLEQRLASEKISELILATNPTVEGEATANYIAELCAEAGVEASRIAHGVPVGGE
LEMVDGTTLSHSLAGRHKIIF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagtccgctgttaactcagcttatggaagcgttgcgctgccttccgggcgtc
ggccctaagtcggcgcagcggatggcgtttaccctgttgcagcgcgatcgcagcggcgga
atgcgcctggcgcaggcgctgacccgggcgatgtcggaaatcggccactgcgccgactgc
cgcacctttaccgagcaggatgtctgtaatatctgttcgaacccgcggcgtcaggaaaac
ggccagatttgcgtggtggagagtcctgcggatatctacgccattgagcagaccgggcaa
ttttccgggcggtatttcgtgctgatgggccacctgtcgccgctggacggcatcgggccg
gatgatatcggtctcgatcgtctggaacagcggctggcgtcagaaaaaatcagcgagctg
atcctcgcgaccaacccgacggttgaaggagaggctaccgcaaactatattgccgagctg
tgcgcggaggccggcgtcgaagccagtcgtatcgcccacggcgtgccggttggcggcgaa
ctggagatggtcgacggtacgacgctgtcccactcgctggcgggacgccataagattatt
ttctga

DBGET integrated database retrieval system