KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0631Help
Entry
SeD_A0631         CDS       T00757                                 

Definition
phage lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Brite
Enzymes [BR:sed01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     SeD_A0631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
635238..635675
Genome map
AA seq 145 aa AA seqDB search
MQISSNGITRLKREEGERLKAYPDSRGIPTIGVGHTGKVDGNPVVSGMTITSEKSSELLK
EDLQWVEDAISSLVRVTLNQNQYDALCSLIFNIGKSAFAGSTVLRQLNLKNYQAAADAFL
LWKKAGKDPDILLPRRRRERALFLS
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatcagcagtaacggaatcaccagattaaaacgtgaagaaggcgaaagactaaaa
gcctatccagatagcagggggataccaaccattggggttggacataccggaaaagtggat
ggtaatcctgtcgtatcagggatgacaatcacatccgaaaaatcgtctgaactgcttaaa
gaggatttgcagtgggttgaagatgctataagtagtcttgttcgcgtcacgctgaatcag
aaccagtatgatgcactatgtagccttatattcaatataggtaaatcagcatttgctgga
tctaccgttctgcgccagttgaatttaaagaattaccaggcagcagcagatgctttcctg
ttatggaaaaaagctggtaaggaccctgatattctccttcctaggaggcggcgagaaaga
gcgctgttcctgtcatga

DBGET integrated database retrieval system