KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0814Help
Entry
SeD_A0814         CDS       T00757                                 

Gene name
kdpA
Definition
(GenBank) K+-transporting ATPase, A subunit
  KO
K01546  
K+-transporting ATPase ATPase A chain [EC:3.6.3.12]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
Two-component system
Brite
KEGG Orthology (KO) [BR:sed00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SeD_A0814 (kdpA)
Enzymes [BR:sed01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.12  K+-transporting ATPase
     SeD_A0814 (kdpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(809976..811655)
Genome map
AA seq 559 aa AA seqDB search
MAAQGFLLIASFLLILLVLAKPLGSGLARLIAAVPLPGVAGVERILWRTLGITDHEMNWR
QYLLALLTLNLLGLGILFCLLFWQEWLPLNPQRLPGLSRDLALNTAVSFVTNTNWQAYSG
ESTLSYFSQMAGLTVQNFLSAATGIAVVFALIRAFTRQNVHTLGNAWQDLVRITLWILFP
VALIIALFFIQQGVPQNLSAYQPITTLEGAKQLLPMGPVASQEAIKMLGTNGGGFFNANS
SHPFENPTALTNLAQMLAIFLIPAALCFAFGEAAGDRRQGRALLWAMSFIFVVCVAVVMW
AEVQGNPHLLAAGADSSVNMEGKETRFGVLASSLFAVVTTAASCGAVNAMHDSFTALGGM
VPMWLMQIGEVVFGGVGSGLYGMLLFVLLAVFIAGLMIGRTPEYLGKKIDVREMKMTALA
ILVTPMLVLLGSALAMMTDAGRSAMLNPGPHGFSEVLYAVSSAANNNGSAFAGLSANSPF
WNCLLAFCMFVGRFGVIIPVMAIAGSLVSKKVQPASQGTLATHGALFIGLLIGTVLLVGA
LTFIPALALGPVAEHFSLP
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgcaaggatttttactgatcgccagttttttactgattttattggtactggcg
aaaccgttgggttcgggcctggcaaggctcatcgccgccgttccgttgccgggcgtggct
ggcgttgagcgtatcctctggcggactcttggcattaccgaccacgaaatgaactggcgt
cagtatttactggcgctactgacgctcaatctgctgggactgggcatcctgttttgcctg
ctgttctggcaggagtggctgcccttaaatccgcagcggctaccggggctgtccagggat
ctggcgctgaataccgccgtcagctttgtcaccaataccaactggcaagcctacagcggc
gaaagcacgctgagctactttagccagatggccgggctgacggtgcaaaatttcctgtcg
gcggcgaccgggattgcggtggtttttgcgcttatccgcgcctttacgcgccagaatgtg
cacacgctgggtaatgcctggcaggatctggtacgcattacgctatggatattatttcct
gtcgcgttaattatcgcgctgttttttatccaacaaggcgtaccgcaaaatctgtcggct
tatcagcccatcaccacccttgaaggcgctaaacaacttttgccgatgggtccggttgct
tcgcaggaggcgatcaaaatgcttggcaccaacggcggcggtttctttaacgccaactct
tcgcatccgttcgaaaaccctaccgcgctcactaatctggcgcagatgctggcgatattt
ttgattccagccgcgctctgtttcgcctttggcgaagcggcgggcgatcgccgtcaggga
cgcgcgctactgtgggcaatgtcattcatttttgtggtctgcgtagcggtagtgatgtgg
gcggaagttcagggaaatccacatctgttggcggcgggcgcggacagtagcgtcaacatg
gagggtaaagaaacgcgctttggcgtgctggccagcagcctgtttgccgtcgtcacgacc
gcggcgtcctgcggggcggtaaatgccatgcacgactcgtttaccgctctgggcggtatg
gtgccgatgtggctgatgcaaattggcgaagtggtctttggcggcgtcggttcaggcctg
tatggcatgttgctgtttgtcctgctggcggtgtttatcgcggggctgatgatcggtcgc
acgccggaatatctggggaaaaaaatcgacgtgcgcgaaatgaaaatgaccgcgctggcg
attctggtcacgccgatgttggtcttgttgggttcggcgctggcgatgatgacggatgcc
ggacgcagcgcaatgctgaaccctggcccgcacggttttagcgaagtgctatatgccgtc
tcctctgccgccaacaacaacggtagcgcctttgcgggtctgagcgctaactcgcctttc
tggaactgtttgctggcgttctgcatgttcgtcggccgtttcggcgtgattattcctgtc
atggccatcgccggatcgctggtcagtaaaaaagtacagccggccagtcagggaacgctg
gcgacccacggcgcgctatttattgggctgctcatcggcacggtactgctggtcggcgcg
ctgacgtttattcctgccctggcgcttggcccggtagcggaacatttctctttaccttga

DBGET integrated database retrieval system