KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0816Help
Entry
SeD_A0816         CDS       T00757                                 

Definition
(GenBank) conserved hypothetical protein
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
812081..812287
Genome map
AA seq 68 aa AA seqDB search
MEHYKDYPAHVIFARRAFAVTAGVLALPVMLFWKDRARFYSYLHRVWSKTSDKPVWMAQA
EKATCDFY
NT seq 207 nt NT seq  +upstreamnt  +downstreamnt
atggaacactataaagactatccagcgcatgtcatttttgcacgtcgtgctttcgcggtg
accgcaggcgtgctggcgttgccggtgatgctcttctggaaagaccgcgcgcgtttttat
agttatctgcaccgtgtctggtcgaaaaccagtgataaaccggtatggatggcgcaggct
gaaaaagccacctgcgacttttattaa

DBGET integrated database retrieval system