KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0818Help
Entry
SeD_A0818         CDS       T00757                                 

Definition
(GenBank) inner membrane transporter YbgH
  KO
K03305  proton-dependent oligopeptide transporter, POT family
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTR2 MFS_1 DUF3290
Motif
Other DBs
NCBI-ProteinID: ACH76853
Position
complement(813859..815340)
Genome map
AA seq 493 aa AA seqDB search
MNKQASQPRAIYYVVALQIWEYFSFYGMRALLILYLTNQLKYDDNHAYELFSAYCSLVYV
TPILGGYLADKVLGNRMAVMLGAFLMAIGHLVLGASEIAPTFLYLSLAIIVCGYGLFKSN
ISCLLGELYQPEDPRRDGGFSLLYAAGNIGSIVAPIACGYVQEEYSWAMGFALAAIGMLA
GLVIFLCGNRHFTHTTGVNKAVLCARNYLLPNWGWLLILLVAAPLLITVLFWKEWSVYAL
IVATAIGLVVLAKIYRQAQTAKQRKELGLIVTLTLFSMLFWAFAQQGGSSISLYIDRFVN
RDILGYSVPTAMFQSVNAFAVMLCGVVLAWLVKESVSGNRTVRIWGKFALGLGLMSAGFC
ILTLSARWSAAYGHSSMPLMVLGLAVMGFAELFIDPVAMSQITRIDIPGVTGVLTGIYML
LSGAIANYLAGVIADQTSQSAFDASGAVNYAINAYVDVFEQITWGALACVGVVLLIWLYQ
SFKFKSRALAVES
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaataaacaagcatctcaaccccgcgctatttactacgttgtcgccctgcaaatttgg
gagtacttcagcttttatggtatgcgcgccctactgattctttatctcaccaatcagcta
aaatacgacgataaccacgcctatgagttattcagcgcttattgttcgctggtctacgta
acgccgattcttggcggctatctggcggataaggtgcttggcaaccgaatggcagtcatg
ctgggcgcatttttaatggctataggtcatttagtgctgggcgccagtgagatcgcgccg
acattcctttatctgtcgctggcgatcattgtctgcggctacggcctgtttaaatcgaat
attagctgcctgctgggcgaactgtaccagccggaagatccgcgccgcgacggcgggttc
tcgctgctttacgcagcgggcaatattggttcgatcgtggcgcctatcgcctgcggctat
gtgcaagaggagtacagttgggcgatgggctttgcgctcgccgccattggtatgctggcg
gggttagtgatcttcctgtgtggaaatcgtcatttcacccacaccaccggcgttaataaa
gccgtgttgtgcgccagaaactacctgctgccgaactggggctggctgttaattctgctg
gtagcggcgccgttgctgattaccgttctgttctggaaagaatggtctgtctatgcctta
atcgtggcgaccgcgatcggcctggtcgtgctggcaaaaatttatcgtcaggcgcaaacg
gccaaacagcgcaaagaactggggctgattgtcaccctgaccctgttcagtatgctgttc
tgggcgtttgcccagcagggcggcagttctatcagcctgtatatcgaccgctttgtgaac
cgcgatattctgggctattccgttcctaccgccatgttccagtcggtgaacgcctttgcc
gtgatgctgtgtggggtcgtcctggcctggctggttaaagagagcgtaagcggtaatcgc
accgtgcgtatctggggcaaattcgcgctgggtctcggtctgatgagcgccggattctgt
attctgaccctgagcgcacgctggtccgccgcttacggacactcttcaatgccgctaatg
gtgctgggactggcggtgatgggctttgccgagctgtttatcgacccggtcgccatgtcg
caaattacgcgcattgatatccccggcgtcaccggcgtattaaccggaatttatatgctg
ctgtccggcgcgatagctaactatctggcaggcgtcatcgctgaccagacctcgcaaagc
gccttcgacgccagcggcgcggttaattacgccatcaacgcctatgtggatgtttttgaa
cagatcacctggggcgcgctagcctgcgtaggggttgtcctgctgatttggctgtatcag
tccttcaaattcaaaagccgcgcgctggccgtcgaatcctga

DBGET integrated database retrieval system