KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0819Help
Entry
SeD_A0819         CDS       T00757                                 

Definition
(GenBank) NIF3 family protein
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
815669..816412
Genome map
AA seq 247 aa AA seqDB search
MKNTELEQLINDKLNSAAISDYAPNGLQVEGKETVQKIVTGVTASQALLDEAVRLQADAV
IVHHGYFWKGESPVIRGMKRRRLKTLLANDINLYGWHLPLDAHPELGNNAQLAALLGITV
KGEIEPLVPWGELSMPVPGLELASWIEARLGRKPLWCGDTGPENVQRVAWCTGGGQSFID
SAARFGVDAFITGEVSEQTIHSAREQGLHFYAAGHHATERGGIRALSEWLNENTALDVTF
IDIPNPA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacaccgagctggaacaactgattaacgacaagctgaacagtgcggcaataagc
gattatgcgccgaatggtttacaggtcgaaggaaaagagacggtacagaaaatcgttacc
ggcgtgaccgcaagtcaggcgctgctcgatgaggcggtgcgtttgcaggccgatgcggtc
attgttcatcatggttacttctggaaaggcgagtctccggttattcgcggtatgaaacgc
cgtcgcttaaaaacgttactggcaaatgatattaacctttacggttggcatctgccgctg
gatgcgcaccctgagctgggcaacaatgcgcagttggcggcgctattaggcattaccgtg
aaaggagaaattgagccgctggtgccgtggggagagctctcaatgccggtgccagggctg
gaactggcctcatggattgaagcgcgtctggggcgtaaaccgctatggtgcggcgatacc
gggccagagaatgtgcagcgtgtcgcctggtgtaccggcggcgggcaaagttttattgat
agcgccgcccgcttcggcgtggatgcttttattaccggcgaggtgtctgaacagaccatt
cattccgcgcgcgaacaggggctgcatttttatgccgccgggcaccatgccactgaacgc
ggcggtattcgcgccctgagcgaatggttgaacgaaaacacggcgttggatgtgacgttt
attgatatccctaacccggcataa

DBGET integrated database retrieval system