KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0821Help
Entry
SeD_A0821         CDS       T00757                                 

Definition
(GenBank) allophanate hydrolase, subunit 2
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CT_A_B
Motif
Other DBs
NCBI-ProteinID: ACH75266
Position
817078..818010
Genome map
AA seq 310 aa AA seqDB search
MLNIIRAGIYTSVQDSGRHGFRQSGLSHCGALDKPAFQTANLLVGNDANAPALEITLGQL
VVEFENETWFALTGAGCEAQLDDQPVWTGWRLPVKAGQRLTLHRPLHGMRSYLAVAGGIA
VPEVMGSCSTDLKSGIGGLEGRLLKDGDRLATGKPSRQFSGPQGVKQLLWGNRIRALPGP
EYREFDRASQEAFWRSPWQLSPQSNRMGYRLQGQSLTRTTDRELLSHGLLPGVVQVPYNG
QPIVLMNDAQTTGGYPRIACIIEADMYHLAQIPLGQPIHFMQCSLEEALNARRERQRYLE
QLTWRLQHEH
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgctgaatattattcgcgcggggatttatacctccgtgcaggatagcgggcgtcacggc
tttcgtcagtcggggctgagtcactgcggcgcgctggataaacccgcctttcagaccgct
aatctcctggtcgggaacgatgcgaatgccccggcgctggaaatcactctcggccaactg
gttgtcgaatttgaaaatgagacctggttcgctcttaccggcgcaggctgcgaggcgcag
ttggatgatcaaccggtctggaccggctggcgattgccggtaaaagcgggtcagcgtctt
acgctgcatcgaccgcttcacgggatgcgtagctatctggcggtggcgggcggtattgct
gtgccggaggtgatgggatcgtgtagtaccgatctgaagtccggcatcggtgggctggaa
ggacggctgctaaaagatggcgatcggctggcgacgggtaaaccatcgcgacagtttagc
gggccgcagggcgtgaagcagttactgtgggggaatcgcatccgtgcgctaccggggccg
gaataccgtgagttcgatcgcgcctcgcaagaagcgttctggcgttcgccatggcagctc
agcccgcaaagtaatcgcatgggctatcgtttgcagggacaatcgttaacgcggacaacg
gatcgcgaactgctgtcgcacggtttgctgcccggtgtcgtgcaggtgccttacaacggc
caacctattgtgctaatgaatgatgcccagacaactggcggctatccgcgcattgcctgc
atcatcgaggcagatatgtaccatctggcgcagatcccgctagggcaaccgatccatttt
atgcaatgttcgctggaagaggcgctcaacgcgcgccgcgagcgtcagcgctatctggaa
cagcttacctggcggcttcagcatgaacattga

DBGET integrated database retrieval system