KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0826Help
Entry
SeD_A0826         CDS       T00757                                 

Gene name
sdhC
Definition
(GenBank) succinate dehydrogenase, cytochrome b556 subunit
  KO
K00241  
succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sed00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SeD_A0826 (sdhC)
   00650 Butanoate metabolism
    SeD_A0826 (sdhC)
  Energy metabolism
   00190 Oxidative phosphorylation
    SeD_A0826 (sdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
822908..823312
Genome map
AA seq 134 aa AA seqDB search
MWALFMIRNVKKQRPVNLDLQTIRFPITAIASILHRVSGVITFIAVGILLWLLGTSLSSP
EGFQQAADIMDGFIVKFIMWGILTALAYHVIVGIRHMLMDFGYLEETFEAGQRSAKISFV
ITVVLSLLAGVLVW
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgtgggcgttattcatgataagaaatgtgaaaaaacaaagacctgtcaatctggatcta
caaacgattcggttccccatcacagcgatagcgtccattctccatcgcgtatccggtgtg
attactttcatcgccgtcggcatactactgtggctactgggcaccagcctctcttctccg
gaaggattccagcaggccgccgatatcatggacggcttcatcgttaaatttatcatgtgg
ggcatccttaccgcgctggcgtatcacgtcatcgtgggaattcgtcacatgttaatggat
tttggctatctggaagaaacattcgaagcgggtcaacgctctgccaaaatctcttttgtt
atcactgtcgtgctttcacttctcgcaggagtcctcgtatggtaa

DBGET integrated database retrieval system