KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0831Help
Entry
SeD_A0831         CDS       T00757                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sed00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SeD_A0831 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SeD_A0831 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    SeD_A0831 (sucB)
Enzymes [BR:sed01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SeD_A0831 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
829494..830702
Genome map
AA seq 402 aa AA seqDB search
MSSVDILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKVVLEVPASADGILDAV
LEEEGTTVTSRQILGRLREGNSAGKETSAKSEEKASTPAQRQQASLEEQNNDALSPAIRR
LLAEHNLEASAIKGTGVGGRLTREDVEKHLAKGESKAPAVEPAAQPALGARGEKRVPMTR
LRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEVFEKRHGIRLGFMSFYVKAVV
EALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLVTPVLRDVDTLGMADIEKKIKELA
VKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAVDGKVE
ILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRLLLDV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatattcttgttcccgacctgcctgagtccgtagcggacgcgaccgtc
gccacctggcataaaaaaccgggcgatgcggttgttcgtgacgaagtgctggtagaaatc
gaaactgacaaagtggtactggaagtaccggcatcagcggacggcattctggatgcggtt
ctggaagaggaggggacgactgtcacctctcgccagatcctgggtcgcctgcgtgaaggc
aacagcgcgggtaaagagaccagcgcgaaatctgaagagaaagcgtctacgccggcacag
cgccagcaggcttcgctggaagaacaaaacaacgatgcgctcagcccggcgatccgtcgc
ctgctggctgaacacaatctggaagccagcgccattaaaggcactggtgtgggtgggcgt
ctgacccgtgaagatgtggaaaaacatctggcgaaaggcgagtctaaagcacccgctgtt
gaacctgcagcgcaacccgctctgggcgcgcgcggcgaaaaacgcgtgccaatgacccgc
ctgcgcaagcgcgtggccgagcgtctgctggaagcgaaaaattccaccgccatgctgacg
accttcaatgaagtcaacatgaagccgattatggatttgcgtaagcagtatggcgaagtg
tttgaaaaacgtcatggtatccgcctgggctttatgtccttctacgtgaaagcggtagtg
gaagcgctgaagcgttatccggaagtgaacgcctctatcgacggcgatgacgtggtgtat
cacaactactttgatgtgagcatggcggtgtctacgccgcgcggcctggtcacgccggtc
ctgcgtgacgtggatacgctgggcatggctgacatcgagaaaaaaattaaagaactggct
gtcaaaggccgcgacggcaagctgaccgtagaagatctgaccggtggtaactttaccatt
accaacggcggcgtattcggttcgctgatgtctaccccgatcatcaacccgccgcagagc
gcgattctgggaatgcatgctattaaagacaggccgatggcggtggatggcaaggtggaa
atcctgccgatgatgtacttggcgctctcttacgatcatcgcctgatcgatggtcgtgaa
tccgtgggcttcctggtcaccatcaaagagttgctggaagatccgacccgtctgctgttg
gacgtgtag

DBGET integrated database retrieval system