KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0833Help
Entry
SeD_A0833         CDS       T00757                                 

Definition
(GenBank) succinyl-CoA ligase [ADP-forming] subunit alpha
  KO
K01902  
succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sed00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SeD_A0833
   00640 Propanoate metabolism
    SeD_A0833
   00660 C5-Branched dibasic acid metabolism
    SeD_A0833
Enzymes [BR:sed01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SeD_A0833
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
832010..832879
Genome map
AA seq 289 aa AA seqDB search
MSVLINKDTKVICQGFTGSQGTFHSEQAIAYGTQMVGGVTPGKGGTTHLGLPVFNTVREA
VEATGATASVVYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEAGVRMI
GPNCPGVITPGECKIGIMPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTCVGIGG
DPIPGSNFIDILKLFQEDPQTEAIVMIGEIGGSAEEEAAAYIKDHVTKPVVGYIAGVTAP
KGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKAIIK
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgtccgttttaattaataaagataccaaggttatctgccagggcttcaccggtagccag
gggactttccactccgaacaggcgattgcttacggtacgcagatggtcggcggcgtaacg
ccgggcaaaggcggcaccacgcatctgggtctgccggtgttcaacaccgtgcgcgaagcg
gtagaagctaccggtgcgaccgcatccgttgtctacgtgccggcgccgttctgcaaagac
tccattctggaagcgatcgacgcaggcatcaaactgattatcaccatcaccgaaggtatt
ccgacgctggatatgctgaccgtgaaagtgaagctggacgaagcgggcgtacgcatgatc
ggcccgaactgcccaggtgtgatcaccccgggcgaatgcaaaatcggcatcatgccgggt
cacattcataagccgggtaaagtgggtatcgtttcccgttccggcacgctgacctatgaa
gcggttaagcagaccaccgactacggtttcggccagtccacctgcgtgggtatcggcggt
gacccgattccgggctctaacttcatcgacatcctgaaattgttccaggaagatccgcag
actgaagcgatcgtgatgatcggcgagatcggcggtagcgcagaagaagaagcggcggct
tatattaaagaccacgtgaccaagccggttgttggctatatcgcgggtgttaccgcgccg
aaaggcaagcgtatgggccacgctggcgccatcattgccggtggtaaaggcactgcggat
gaaaaattcgccgcgctggaagccgcgggcgtgaaaaccgttcgcagcctggccgatatc
ggcgaagcgctgaaagcaattataaaataa

DBGET integrated database retrieval system