KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0833Help
Entry
SeD_A0833         CDS       T00757                                 

Definition
(GenBank) succinyl-CoA ligase [ADP-forming] subunit alpha
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
sed00020  Citrate cycle (TCA cycle)
sed00640  Propanoate metabolism
sed00660  C5-Branched dibasic acid metabolism
sed01100  Metabolic pathways
sed01110  Biosynthesis of secondary metabolites
sed01120  Microbial metabolism in diverse environments
sed01130  Biosynthesis of antibiotics
sed01200  Carbon metabolism
Module
sed_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sed_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sed00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SeD_A0833
   00640 Propanoate metabolism
    SeD_A0833
   00660 C5-Branched dibasic acid metabolism
    SeD_A0833
Enzymes [BR:sed01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SeD_A0833
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: ACH74510
Position
832010..832879
Genome map
AA seq 289 aa AA seqDB search
MSVLINKDTKVICQGFTGSQGTFHSEQAIAYGTQMVGGVTPGKGGTTHLGLPVFNTVREA
VEATGATASVVYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEAGVRMI
GPNCPGVITPGECKIGIMPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTCVGIGG
DPIPGSNFIDILKLFQEDPQTEAIVMIGEIGGSAEEEAAAYIKDHVTKPVVGYIAGVTAP
KGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKAIIK
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgtccgttttaattaataaagataccaaggttatctgccagggcttcaccggtagccag
gggactttccactccgaacaggcgattgcttacggtacgcagatggtcggcggcgtaacg
ccgggcaaaggcggcaccacgcatctgggtctgccggtgttcaacaccgtgcgcgaagcg
gtagaagctaccggtgcgaccgcatccgttgtctacgtgccggcgccgttctgcaaagac
tccattctggaagcgatcgacgcaggcatcaaactgattatcaccatcaccgaaggtatt
ccgacgctggatatgctgaccgtgaaagtgaagctggacgaagcgggcgtacgcatgatc
ggcccgaactgcccaggtgtgatcaccccgggcgaatgcaaaatcggcatcatgccgggt
cacattcataagccgggtaaagtgggtatcgtttcccgttccggcacgctgacctatgaa
gcggttaagcagaccaccgactacggtttcggccagtccacctgcgtgggtatcggcggt
gacccgattccgggctctaacttcatcgacatcctgaaattgttccaggaagatccgcag
actgaagcgatcgtgatgatcggcgagatcggcggtagcgcagaagaagaagcggcggct
tatattaaagaccacgtgaccaagccggttgttggctatatcgcgggtgttaccgcgccg
aaaggcaagcgtatgggccacgctggcgccatcattgccggtggtaaaggcactgcggat
gaaaaattcgccgcgctggaagccgcgggcgtgaaaaccgttcgcagcctggccgatatc
ggcgaagcgctgaaagcaattataaaataa

DBGET integrated database retrieval system