KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0838Help
Entry
SeD_A0838         CDS       T00757                                 

Definition
(GenBank) cyd operon protein YbgT
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
837200..837313
Genome map
AA seq 37 aa AA seqDB search
MWYFAWILGTLLACAFGIITALALEHVEAGKTGQEES
NT seq 114 nt NT seq  +upstreamnt  +downstreamnt
atgtggtatttcgcatggattctgggaacgcttcttgcctgtgcattcgggatcattacc
gccctggcgcttgagcacgttgaagcgggtaaaaccggtcaagaagaaagctaa

DBGET integrated database retrieval system