KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0842Help
Entry
SeD_A0842         CDS       T00757                                 

Gene name
tolR
Definition
(GenBank) protein TolR
  KO
K03560  biopolymer transport protein TolR
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Brite
Transporters [BR:sed02000]
 Other Transporters
  Pores ion channels [TC:1]
   SeD_A0842 (tolR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ExbD
Motif
Other DBs
NCBI-ProteinID: ACH75532
Position
838932..839360
Genome map
AA seq 142 aa AA seqDB search
MARTRGRGRRELKSEINIVPLLDVLLVLLLIFMATAPIITQSVEVDLPEANQSQAVSSND
DPPVIIEVSGVGQYSVVVDKDRMDQLPSEQVIAEVKRHLQANPKTVFLIGGAKEVPYDEI
IKALNLLHSAGVKSVGLMTQPI
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atggccagaacgcgtggacgaggtcgtcgcgaacttaagtccgaaatcaatattgtaccg
ctactcgacgtactgttggtgttgctgctgatctttatggcaaccgcgccgatcattacc
cagagcgtggaggtcgacttgccggaggcgaatcagtcgcaggcggtcagtagtaacgac
gatccaccggtcattattgaggtttccggagtagggcaatacagcgtagtggttgataaa
gatcgaatggatcaactgccgtctgaacaggtgatcgcagaagtaaagcgtcatctgcag
gctaatccgaaaacagtctttttaatcggcggcgcgaaagaggtgccgtacgatgaaata
attaaagcgctgaacttgttacacagcgcgggcgtaaaatcggttggcttaatgacgcag
ccaatctga

DBGET integrated database retrieval system