KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0843Help
Entry
SeD_A0843         CDS       T00757                                 

Gene name
tolA
Definition
(GenBank) protein TolA
  KO
K03646  
colicin import membrane protein
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Brite
Transporters [BR:sed02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   SeD_A0843 (tolA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
839425..840603
Genome map
AA seq 392 aa AA seqDB search
MSKATEQNDKLKRAIIISAVLHIILFAVLIWSSFDEHIEASAGGGGGSAIDAVMVDPGAV
VQQYNRQQDQQASARRAEEERKKLQQQQAEELQQKQAAEQERLKQLEKERLAAQEQQKQA
EEAAKLAQQQQQQAEEAAKAAADAKKKAEAEAAKAAADAKKKAEAEAAKAAADAKKKAEA
EAVKAAADAKKKAEAEAAKAAAEAKKKAEAEAAKAAAEAKKKADAEAAKAAAEAKKKADA
AAAKAAADAKKKAAAEKAAAAEGVDDLLGDLSSGKNAPKTGGGAKGNGQPSKDSGTSGAN
GGATGADISAYAKQIQVAIQSRLYDASLYQGKQCVLHISLAPDGSLKSITSEGGDPALCQ
AALMAAKTAKIPKPPSQAVYEKIKDAKLDFKL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaaaggcaaccgaacaaaacgacaagctcaaacgggcgataattatttcagccgtg
ctgcatatcatcttatttgcagtgctgatctggagttcgtttgatgagcatatagaggct
tctgccggcggcggcggtggttccgctatcgacgcggtgatggtcgatcctggcgccgtt
gtgcagcagtacaaccgtcagcaggatcaacaggccagcgccagacgcgcggaagaagag
cgtaaaaagctgcaacagcagcaagcagaggagctgcagcagaagcaggctgccgaacag
gagcggttgaaacaacttgagaaagaacgtttagcggctcaggagcagcaaaagcaggct
gaagaagcggcaaaactggcgcaacagcagcagcaacaggccgaagaagcggcgaaagcg
gcggcggacgcgaagaaaaaagcggaggccgaagcggcgaaagcggcggcggacgcgaag
aagaaagcggaggccgaagcggcgaaagcggcggcggacgcgaagaagaaagcggaagcc
gaggcggtaaaagcggcagcggacgcgaagaagaaagcggaagccgaagcggcgaaagcg
gcggcggaggcgaagaagaaagcggaagccgaagcggcgaaagcggcggcggaggcgaag
aagaaagcggatgccgaggcggcgaaagcggcggcggaggcgaagaagaaagcggatgcc
gcggcggcgaaagcagcggcggacgctaagaagaaagcggctgccgaaaaagcggccgcc
gcagaaggcgtcgacgatctgcttggcgatctcagctcgggtaagaatgcgccgaaaacc
ggcggcggcgcgaaagggaatggtcagccatcgaaagatagcggtacatcgggcgctaac
ggtggggcgacaggcgctgatatcagcgcctacgcgaaacagattcaggtcgccattcag
agccgtctgtatgatgcgagcctgtatcagggcaaacaatgtgtcttgcatattagcctg
gcgccggatggctcattaaaaagcattacgtctgagggcggcgatccggcgctttgtcag
gcggcgttaatggcggcaaaaaccgcgaaaattcctaaaccgccaagccaggctgtttat
gagaaaataaaggatgccaaactagactttaaactgtag

DBGET integrated database retrieval system