KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0844Help
Entry
SeD_A0844         CDS       T00757                                 

Gene name
tolB
Definition
(GenBank) tol-Pal system beta propeller repeat protein TolB
  KO
K03641  
TolB protein
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Brite
Transporters [BR:sed02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   SeD_A0844 (tolB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
840724..842019
Genome map
AA seq 431 aa AA seqDB search
MMKQALRVAFGFLMLWAAVLHAEVRIEITQGVDSARPIGVVPFKWAGPGAAPEDIGGIVA
ADLRNSGKFNPLDRSRLPQQPATAQEVQPTAWSALGIDAVVVGQVTPNPDGSYNVAYQLV
DTGGAPGTVLAQNSYKVNKQWLRYAGHTASDEVFEKLTGIKGAFRTRIAYVVQTNGGQFP
YELRVSDYDGYNQFVVHRSPQPLMSPAWSPDGSKLAYVTFESGRSALVIQTLANGAVRQV
ASFPRHNGAPAFSPDGTKLAFALSKTGSLNLYVMDLASGQIRQITDGRSNNTEPTWFPDS
QTLAFTSDQAGRPQVYKMNINGGAAQRITWEGSQNQDADVSSDGKFMVMVSSNNGQQHIA
KQDLVTGGVQVLSSTFLDETPSLAPNGTMVIYSSSQGMGSVLNLVSTDGRFKARLPATDG
QVKSPAWSPYL
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagcaggcattacgagtagcatttggttttctgatgctgtgggcggcggtgctg
cacgcagaagtccgtatcgagatcacccagggggtggactcggcgcgaccgattggcgtt
gtgccttttaaatgggccgggccgggcgctgcgcctgaagatatcggcggcatcgtggcg
gcagatttacgtaatagcggtaaatttaatccgttagaccggtcccgactgccgcagcag
ccagccaccgctcaggaagttcagcctaccgcatggtctgcgctgggtattgatgccgtc
gtcgttgggcaggtaacgccgaatccggacggttcctacaatgttgcttatcagctggtt
gacactggcggcgcgccggggactgtactggcgcaaaattcttataaagtgaacaagcag
tggctgcgttatgcaggtcataccgccagtgacgaagtctttgaaaaactgacgggcatt
aagggcgcgttccgtactcgtatcgcctatgtggtacagactaatggcggtcagttcccg
tatgaactgcgtgtgtcggattacgatggttacaatcagtttgtggtgcaccgttctccg
cagccgttgatgtctccggcgtggtctccggacggctcaaaactggcttacgtgacattt
gaaagcggtcgctccgcgctggttatccagacgctggcaaacggcgcagtgcgtcaggtt
gcgtccttcccgcgtcacaacggcgcgccggccttctcgccggatgggacgaaactggcg
ttcgcgttatcgaaaaccggaagtctgaacctgtacgttatggatcttgcttccggccag
attcgtcagataacggacgggcgtagcaacaatacggagccgacctggttcccggacagc
cagactctggcctttacctctgaccaggctggacgtccgcaagtgtataaaatgaacatt
aacggcggtgcggcgcagcgtattacctgggaaggttcgcaaaaccaggatgcggatgtc
agcagcgacggtaaatttatggtaatggtaagctcaaataacgggcagcagcacattgcc
aaacaagatctggtgacgggtggcgtacaggttctgtcgtcaacgttcctggatgaaacg
ccaagtctggcacctaacggcacgatggtaatctacagctcttctcaggggatgggatct
gtgctgaatttggtttctacagatgggcgtttcaaagcgcgtcttccggcaactgatggt
caggtgaaatcgcctgcctggtcgccgtatctgtga

DBGET integrated database retrieval system