KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0846Help
Entry
SeD_A0846         CDS       T00757                                 

Definition
(GenBank) tetratricopeptide TPR_2 repeat protein
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TolA_bind_tri TPR_6 TPR_16 TPR_2 YfiO TPR_17 TPR_18 TPR_8 TPR_21 DUF4810 ANAPC3 TPR_12 DUF812 Reo_sigmaC Spc7 TPR_19 MscS_porin DUF3552 DUF4407 HrpB7 COG2
Motif
Other DBs
NCBI-ProteinID: ACH78052
Position
842588..843376
Genome map
AA seq 262 aa AA seqDB search
MSSNFRHHLLSLSLLVGIAAPWAAFAQAPISSVGSGSVEDRVTQLERISNAHSQLLTQLQ
QQLSDNQSDIDSLRGQIQENQYQLNQVMERQKQIMLQLGSLNNGGAAQPAAGDQSGTATT
ATPAPDAGTATSGAPVQSGDANTDYNAAIALVQDKSRQDDAIVAFQNFIKKYPDSTYQPN
ANYWLGQLNYNKGKKDDAAYYFASVVKNYPKSPKAADAMYKVGVIMQDKGDTAKAKAVYQ
QVINKYPGTDGAKQAQKRLNAM
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtaacttcagacatcacctgttgagtctgtcgttactggttggcatagcggcc
ccctgggccgcttttgctcaggcgccaatcagtagtgtcggctcaggctcggtcgaagac
cgcgtcactcaacttgagcgtatctctaacgctcacagccagcttttaacccaacttcag
cagcagctctccgataatcagtccgatatcgattctttgcgcggccaaatccaggaaaat
cagtatcaactgaatcaggtgatggagcgccagaagcaaattatgctgcagctggggagc
ttgaataatggcggcgcagcgcagccagcagctggtgaccagagcgggacggcaaccact
gcgacccccgccccggatgccggtacggcaacctcaggggcgccggtacaaagtggcgat
gcgaataccgattacaatgcggcaattgcgctggtgcaggataagtctcgccaggatgat
gcgattgtggcgtttcagaacttcatcaagaaataccctgattctacttatcagccgaac
gccaattattggctgggccagttgaattacaacaagggtaaaaaagatgacgccgcctat
tatttcgcctcggtagtaaaaaactatcctaagtcgccgaaggctgcggacgcgatgtac
aaagttggcgttatcatgcaggacaaaggtgatacggcaaaagcgaaagcggtttatcag
caggtgattaacaaatatcctggcactgatggcgcgaaacaggcgcagaagcgtcttaac
gcgatgtaa

DBGET integrated database retrieval system