KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0846Help
Entry
SeD_A0846         CDS       T00757                                 

Definition
(GenBank) tetratricopeptide TPR_2 repeat protein
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
842588..843376
Genome map
AA seq 262 aa AA seqDB search
MSSNFRHHLLSLSLLVGIAAPWAAFAQAPISSVGSGSVEDRVTQLERISNAHSQLLTQLQ
QQLSDNQSDIDSLRGQIQENQYQLNQVMERQKQIMLQLGSLNNGGAAQPAAGDQSGTATT
ATPAPDAGTATSGAPVQSGDANTDYNAAIALVQDKSRQDDAIVAFQNFIKKYPDSTYQPN
ANYWLGQLNYNKGKKDDAAYYFASVVKNYPKSPKAADAMYKVGVIMQDKGDTAKAKAVYQ
QVINKYPGTDGAKQAQKRLNAM
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtaacttcagacatcacctgttgagtctgtcgttactggttggcatagcggcc
ccctgggccgcttttgctcaggcgccaatcagtagtgtcggctcaggctcggtcgaagac
cgcgtcactcaacttgagcgtatctctaacgctcacagccagcttttaacccaacttcag
cagcagctctccgataatcagtccgatatcgattctttgcgcggccaaatccaggaaaat
cagtatcaactgaatcaggtgatggagcgccagaagcaaattatgctgcagctggggagc
ttgaataatggcggcgcagcgcagccagcagctggtgaccagagcgggacggcaaccact
gcgacccccgccccggatgccggtacggcaacctcaggggcgccggtacaaagtggcgat
gcgaataccgattacaatgcggcaattgcgctggtgcaggataagtctcgccaggatgat
gcgattgtggcgtttcagaacttcatcaagaaataccctgattctacttatcagccgaac
gccaattattggctgggccagttgaattacaacaagggtaaaaaagatgacgccgcctat
tatttcgcctcggtagtaaaaaactatcctaagtcgccgaaggctgcggacgcgatgtac
aaagttggcgttatcatgcaggacaaaggtgatacggcaaaagcgaaagcggtttatcag
caggtgattaacaaatatcctggcactgatggcgcgaaacaggcgcagaagcgtcttaac
gcgatgtaa

DBGET integrated database retrieval system