KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0851Help
Entry
SeD_A0851         CDS       T00757                                 

Gene name
nadA
Definition
(GenBank) quinolinate synthetase complex, A subunit
  KO
K03517  
quinolinate synthase [EC:2.5.1.72]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Module
NAD biosynthesis, aspartate => NAD
Brite
KEGG Orthology (KO) [BR:sed00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SeD_A0851 (nadA)
Enzymes [BR:sed01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.72  quinolinate synthase
     SeD_A0851 (nadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
844357..845460
Genome map
AA seq 367 aa AA seqDB search
MAFVTLSFGYFVKSVKRETTMSVMFDPQAAIYPFPPKPTPLNDDEKQFYREKIKRLLKER
NAVMVAHYYTDPEIQQLAEETGGCISDSLEMARFGAKHAASTLLVAGVRFMGETAKILSP
EKNILMPTLAVECSLDLGCPIDEFSAFCDAHPDRTVVVYANISAAVKARADWVVTSSIAV
ELIEHLDSLGEKIIWAPDRHLGNYVQKQTGADVLCWQGACIVHDEFKTQALTRLKKIYPY
AALLVHPESPQSIVEMADAVGSTSQLIKAAKTLPHRQLIVATDRGIFYKMQQAVPEKELL
EAPTAGEGATCRSCAHCPWMAMNGLKAIAEGLEQGGAAHEIQVDAALREGALLPLNRMLD
FAATLRA
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
gtggcgtttgttacgctttcattcggttatttcgttaagtcagtaaaacgagaaaccacg
atgagcgtaatgtttgacccacaagccgcaatctacccgttcccgccgaaaccaacgccg
ttgaacgacgatgaaaagcaattttatcgtgagaaaatcaagcgtttgctcaaagagcgc
aatgccgtcatggtggcgcactactacaccgatccggaaattcaacagttagcagaagaa
accggcggctgtatttccgactcgctggaaatggcccgtttcggcgcgaagcacgccgca
tccacgttactggtagcgggcgtacggtttatgggggaaaccgccaaaatcctcagcccg
gaaaaaaacattcttatgcctacgctggcggtggaatgttcgctggatttaggctgccca
atagacgaatttagcgctttttgtgatgcgcaccctgacagaaccgtagtggtctatgct
aacatctcggctgctgttaaagcgcgtgcggactgggttgtgacctccagtatcgccgta
gaactgattgagcatctggatagtttgggggaaaaaattatctgggcgccggacagacac
ctggggaattacgtgcaaaaacagaccggggccgatgtactgtgttggcaaggggcgtgt
atcgtgcatgacgagtttaaaacccaggcgttgacccgtttaaaaaaaatctatccctat
gccgctcttctggttcaccctgaatcgccgcagtccattgtcgagatggccgatgcggtg
ggctccaccagtcagcttattaaggcggcaaaaacgctgccgcacagacagcttatcgtg
gcgaccgatcgcggcatcttctacaaaatgcagcaggcggtgcctgaaaaagaactgctt
gaagcgcccacggctggcgagggggcgacctgccgtagctgcgcgcactgtccgtggatg
gcgatgaatggcctgaaagccattgctgaagggctggagcagggaggcgcggcgcatgaa
atacaggttgatgcggcgctacgcgagggcgcattactgccgctcaaccggatgctggat
tttgcggctacacttcgggcgtaa

DBGET integrated database retrieval system